SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225344 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225344
Domain Number 1 Region: 94-154
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000418
Family Tachycitin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225344   Gene: FBgn0198195   Transcript: FBtr0226852
Sequence length 1173
Comment type=protein; loc=scaffold_12855:join(5913236..5913269,5915682..5915728,5915791..5916057,5916116..5919289); ID=FBpp0225344; name=Dvir\GJ10927-PA; parent=FBgn0198195,FBtr0226852; dbxref=FlyBase:FBpp0225344,FlyBase_Annotation_IDs:GJ10927-PA,GB_protein:EDW59515,REFSEQ:XP_002056403,FlyMine:FBpp0225344; MD5=49cd6ab4d09a734b56c9df8bd6e98a2a; length=1173; release=r1.2; species=Dvir;
Sequence
MRRTQIHLLCCALLLVAYLSQASAETKLRTPARILAKQTGATQFEEERYETHTNCNEHKH
HLKKRASDEDVDYEVYQGVVGRPGIDFPIYPRIPKTTFSCRSYGNGYFADMETDCQVFHI
CEEGRKISFLCPNGTIFQQSELTCDWWFKVNCLGSSGYYAESAEILNKQRVHRVRPSVPV
QGFNIVGGGLNIKPKVTPAVGQGRASTRAGSKSDRRIDSTEDLHASLESVDFDDVSGEKQ
RKVLPSIDNNNNEHETQIAAESSSFVSGANKRRNNNNSNGNSNSNPNSNDDATILKPTRS
RSSSSSSQERSTKVRGESRERARNGQRGQQRYKELDSEEQQSKEKNRDKLKDKPEFYETH
SIRPVQHTTPYYTPSSYSTVRRLEPSKSTPYYTPTVPSVPKSKSTEGKLNYIKGVHSATT
PNPNRFGSAGISSLFLESSQAPKSAKPTASASLELDSTYRPVIIGMRHHYDVAGSGELKR
LALSINSNTEQAAKKSESNRVIVPTTPAPTATSSGPTYLPKVGAVVPRSNAEAAGGESLL
FAPNPVNEESVYRNVQDMLKTVSLLKDQFEDVELNAQPASNARAGLEIPPSSGPDALVSL
AKYFAQEHNESSNALLKPVKSVVHTKLSAKPPAPAPLLPTVKPSDTTATLTTSETPPSIS
EQADDIKQSLLSAKTVQKYSNLFGLKVAKGRGSAEGQADISTGLLSAQLNETQLPAKSAD
YQPFPQIGSTGSTIGALAEKPESRKIAQIFSNALTSYLDNPGSFRAELAARARPTEPPNF
KPVTTTDSTLFSDGTAKYYLPTKPSPDVTTPQNIAFEINHKFDSTPAPEYSTTTELYELS
TSRAHDSELELSGELSPASLDSGEGDESLQQQQTQSFVKSRNDLLQDARPQKLITTHKPT
ENPWALKSQTDFLDPLTINDALMKEQRTTTTTTTTTSTSTPFTYSPRSLGGSTTGAQTTT
STPAHYEWDDIFRSYDIPRDALPSSTGLQRIANKLFGGLNEQEALHLRNVMAKAEHDRQV
LSLLLLLIQTCDDSNGKALERSRKHLLNALIDIDSKLPGKNVARQQLATTTTRVPVTTFR
RTGNADYYTSTTAPGYTTSTEQPLSTSTSTAPGSYEETTKFEIRVEDVDDADLAATTPAT
APAPAHTEIHSDRRALELLKSLYSLASKFSSRR
Download sequence
Identical sequences 7244.FBpp0225344 FBpp0225344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]