SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225346 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225346
Domain Number 1 Region: 185-241
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000392
Family Tachycitin 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225346   Gene: FBgn0198197   Transcript: FBtr0226854
Sequence length 405
Comment type=protein; loc=scaffold_12855:join(5920889..5920922,5922081..5922127,5922189..5923325); ID=FBpp0225346; name=Dvir\GJ10929-PA; parent=FBgn0198197,FBtr0226854; dbxref=FlyBase:FBpp0225346,FlyBase_Annotation_IDs:GJ10929-PA,GB_protein:EDW59516,REFSEQ:XP_002056404,FlyMine:FBpp0225346; MD5=e7370a0505b2fb99bb9d27feda3808b7; length=405; release=r1.2; species=Dvir;
Sequence
MLLQRYAALLAVFLLLWCGSGAQLQVQAQSGYNYVRPELPTTAGGGAIATRLQPGAYPTG
TALPLTPAPATAYGAGLFPSPAVSYTPSGQATTAFGAPATAPVGSVPNLPRRPTGSGLQS
ASSAARGGPYGPQPQYSNTAGASSGARVPLADDYNDGADGDYSAIPGEPGVDYPVYAQVP
RTNFDCSQQPLPGYYADIEAQCQVFHICALNRTYSFLCPNGTVFSQETLVCVWWNQYDCV
SAPSLYANNAYIYDYSGTSSSSSSSNLNLNANVYRGGSQPVNTAYGAVAPSTPAGGALRA
TGAPQIAGYNAQRGAYASPSPTPTQAQSLYGAGAIIRPAGVSGTVSAPGANRLAPATAAA
GLAATAAGLLPDNAVGSFAQPVVAVGNREYLPPATVSQRQQRTQA
Download sequence
Identical sequences B4M4F5
FBpp0225346 7244.FBpp0225346 XP_002056404.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]