SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225672 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225672
Domain Number 1 Region: 1181-1239
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 3.66e-16
Family Tachycitin 0.0077
Further Details:      
 
Domain Number 2 Region: 1642-1704
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 5.49e-16
Family Tachycitin 0.0058
Further Details:      
 
Domain Number 3 Region: 987-1044
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 8.89e-16
Family Tachycitin 0.011
Further Details:      
 
Domain Number 4 Region: 1725-1781
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000118
Family Tachycitin 0.032
Further Details:      
 
Domain Number 5 Region: 1566-1622
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000288
Family Tachycitin 0.012
Further Details:      
 
Domain Number 6 Region: 19-69
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000915
Family Tachycitin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225672   Gene: FBgn0198516   Transcript: FBtr0227180
Sequence length 1782
Comment type=protein; loc=scaffold_13049:complement(23981874..23987212,23987276..23987285); ID=FBpp0225672; name=Dvir\GJ11255-PA; parent=FBgn0198516,FBtr0227180; dbxref=FlyBase:FBpp0225672,FlyBase_Annotation_IDs:GJ11255-PA,GB_protein:EDW70965,REFSEQ:XP_002048623,FlyMine:FBpp0225672; MD5=388f4fd43bd47ab0fc0dbf0c56c37496; length=1782; release=r1.2; species=Dvir;
Sequence
MQLVNFLWIGLLTIPQAFALDACAGQHFGYKAVDPADPHAYYLCLGLVGKIRNTCAEGFR
FNVQAQNCAQVQLSNSGSGPNNEFNINQNITLDRPIIFNIFGYLFNRPPNFPTTTPPSIG
TTTKTLPGENESTTITQLFPKSTTHGINTTPDGLDTSTRSSTPGSLQSTATVTQPSETST
EISSSSSEASSSSAESSTEGSRSSSEDSSSIETTEPSETSTKSSTEISEAASTETSKSST
DSSSSSSEGSTSEITEPSESSTESSRSSSEDSSSAVPEPSESSTESYSSSSEAPSSSEVT
EPSDSSTESASSSSEAPSSSAVTDQTESSTENSVESSSPSSQASSSSEVTDPSESSTESS
SSSSQEPSESSTESSSSSSEGSSSEKTEPSESSTESSSSSSEALSSSEVTDPSESSTESS
SSSSQEPSESSTESSSSSSEGSSSEKTEPSESSTESSSSSSEALSSLAVTDPSESSTESS
SSSSQEPSEISTESSSSSSEGSSSEITEPSESSTESSSSSSEDSSSAVTEPLESSTESFS
SSSEAPSSSEVTEPSDSSTESSSSSSEASSSSAVTDQTESSTESSVESSSPSSQASSSSE
VTDPSESSTEGSSSSSQEPSESSTESSSSSSEVSSSEITEPSESSTESSSSSSEATSSSE
VTEPSESSTESSVESSSSSSQASSSSEVTDPSESSTESSSSSSQEPLESSTESSSSSSEG
SSAEKTEPSESSTESSNSSSEASSSSAVTDSSESSTESSSFSSQEPTESSTESSSSSSEV
SSSEITEPTESSTESSSSSSEASSSAVMDQTESLTKSSTESSSSSSEALSSSAVTQPSDS
TESSSSSSEEPSEFSTEISSSSSDGSSSSDITEPSESSTESSSSSSDPSSSAVTDPLESS
TESSSSSSEASSSSAITDQAESSTDSSTSSSSSAGPEAAVSPIGVFAALQLLPIGLNAGK
PSEGLKKTLWTPTAHGATFSTDGTKESSYCALLPNGAYIRDPKSCSKFYVCANGGSISRK
CPGNLYFDIEKNICNFPSLVDCSKQQQLFSNAVGISSENLLTSDGRKPSLDAPSTPEASE
NISSDNNSILLDKPLSVSAVTKITLGNPTEERTKLSSAEDNSSSSENYLASPKVTVSTGI
GLQGSKQFAPAIEDLKQLEHMSLKQGIREMNPELVATEVEERSVCSSLPNGAYLRDSKSC
SKFYICANGQAISRSCPKNLYFDVKKKVCNFPQLVECLSSDDQSNNYRNPLPKPNKNLDG
VRIVKTTSTGSTLRSPPKPKPSSESTIVVPKVSKKSEEEGSPIASSSQNSFVSSSKVIKS
QSASADQGNRSTKKTQIPAAQKQQQGRPFVAGHIKSQDAEIPSLKNVVSSSKAIKSPSAS
ADQSNTSSKKTQIPAAQKQQQGKPIEVGHIKSQDAEISSLKNVVSSSKVIKSQSASADQG
NRSTKKTQIPAAQKQQQGKPIEVGHIKSQDAEISSIKNVVSSSKVIKSQSASADQGNRST
KKTQIPAAQKQQQGKPIVAGHIKAQGAEIISSTKTEIYKKPARVLNTGKRIKPREPMLVP
SGVESSDCSFLPNGAFIRDSKLCGKFYVCANGRAVPKNCPGILYFDIKKRVCNFPSLVDC
RNNNDAHTAAPVKPSTTSVLPPSTPIPDCSSLQNGVYLRHPNSCSKFYVCANGRAIAREC
PKGLYIDTEIKYCDFPSRVACSLDAPQIPNRAQGLANIAATTLGEPDCRDKVDGTTLRDA
KQCNKYYICVKGTPATHFCAPGKWFDLNRRVCDPKRLVECSN
Download sequence
Identical sequences B4LCS3
FBpp0225672 XP_002048623.1.90633 7244.FBpp0225672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]