SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225688 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225688
Domain Number 1 Region: 475-666
Classification Level Classification E-value
Superfamily MIR domain 3.01e-53
Family MIR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225688   Gene: FBgn0198532   Transcript: FBtr0227196
Sequence length 916
Comment type=protein; loc=scaffold_13049:complement(23779723..23780456,23780515..23781291,23781864..23782426,23782503..23783179); ID=FBpp0225688; name=Dvir\GJ11271-PA; parent=FBgn0198532,FBtr0227196; dbxref=FlyBase:FBpp0225688,FlyBase_Annotation_IDs:GJ11271-PA,GB_protein:EDW70930,REFSEQ:XP_002048588,FlyMine:FBpp0225688; MD5=25bf8b96ab1ba51ff949fa821d66ac0c; length=916; release=r1.2; species=Dvir;
Sequence
MSSHSVQRRKTTRSKSKQQQQQQQQQQRQNVAENLIENQNASNEQNERLHFRSRSATSVG
ALAAAAAAAAAPIDCNSTSPLCCNGMLPTTAITMLNCCRDINCHLNTPLALPLRGSVERS
RRSASRQSFLASETLKPTTTASPTPTSASKQSRSLSRSRSRSRSRSCSCDVGGNSCNIGD
PLRQSPDSAAAAKLTVSLHIDLISWGLFLLAFLTRFYKLATPPHVVFDELHYGKYISHYM
RNIFFFDQHPPLGKQLIAGLVSFVGYDGNYTFPRIGATYASNVPVFWLRFVPALCGSLLA
PAVYKLLLEAQLRRWAAALGGLLVVLDNALLTQSRFILMESMLLLASTVGIACLLRFQRC
SLGSLNWLSSGAAAALFLACAGCVKYVGFLALALAGYLLCRHLWKLLYDATLTNGQLWLH
ALGRLLLFVGIPLAVYLGVFYVHLKTLHRAGPHDTIMTSAFQASLDGGLASITRGQPLAV
VHGSQITLRHTHGRTCWLHSHAAVYPVRYKDQRGSSHQQQVTCYSFKDVNNWWIVKRPER
DDLVVGEQPDVIRHGDVIQLVHGITSRALNSHDVAAPMTPQCQEVSCYIDYEIKMAGELL
WRVEILNRQTEGDRWHAIKSEIRLIHETTGAALRFSGRQLPSWGFNQHEVVADRDPMHQD
AIWNVEEHRYTKTQDQRERERQLLSAEMIPTKRTKLSFWAKLLELQTKMFWHAKQVQSHM
YSSQPHEWPLLDKGIAYWLDDSSSAQIYLLGNVLIWYMASAGLFLYAALLVFYALRRRRL
CFDVSAGEWRRFLGAGDTFFVGYLVHYLPYFFVDRTLFLHNYLPAFVFKLLLLCYVLDHV
DYLLWSHCSRSRSRLAVHLVRIYRLALLLWLIAVCAVFIKFLPLSYGSRKMSAKEIIDLR
WKDTWDFILQKNYALQ
Download sequence
Identical sequences B4LCN8
XP_002048588.1.90633 XP_015030404.1.90633 FBpp0225688 7244.FBpp0225688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]