SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225823 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225823
Domain Number 1 Region: 345-409
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000162
Family Tachycitin 0.0097
Further Details:      
 
Domain Number 2 Region: 174-234
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000445
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 23-85
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000811
Family Tachycitin 0.0066
Further Details:      
 
Domain Number 4 Region: 421-480
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000314
Family Tachycitin 0.024
Further Details:      
 
Domain Number 5 Region: 252-305
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000152
Family Tachycitin 0.026
Further Details:      
 
Weak hits

Sequence:  FBpp0225823
Domain Number - Region: 316-336
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000523
Family Tachycitin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225823   Gene: FBgn0198664   Transcript: FBtr0227331
Sequence length 481
Comment type=protein; loc=scaffold_13049:complement(21097656..21098742,21098833..21099166,21099224..21099248); ID=FBpp0225823; name=Dvir\GJ11406-PA; parent=FBgn0198664,FBtr0227331; dbxref=FlyBase:FBpp0225823,FlyBase_Annotation_IDs:GJ11406-PA,GB_protein:EDW70676,REFSEQ:XP_002048334,FlyMine:FBpp0225823; MD5=2b31ef691651a69081628be11efa9309; length=481; release=r1.2; species=Dvir;
Sequence
MCKIKEGIALIGCLLLMGVQCTVAQWSDICDDEADGTRLPVALDCARFVVCQEREVAEIR
RCPRGLHFNAQLGECDFQWRADCRALSLFGKIAGDEECVCTCCAEECPDDELDQPTTPCP
EGTTKDSTPTEGTTKESTTRESTTKESTFDPDPTEAPGSSTDPPTGGAVPAYCVDKRPDC
VNQPDGVMLELPGVCTKFIQCSHGCVTEQICPSGLYFDPSQYACNHPWNVDCTPADADDV
DGELAGPSGTSCSDQGVCAGQRDGKMFANPDTNGYFVCQCQCPVAMPCDANTKFNETAQV
CDWDLTSGTIGGSSSVICPNGLVYNATSNQCDYPDGYVPEVVCENTSTICKGKPEGTLFP
IEGICNKFYKCNYNCAVEKTCPNNLVYDSKAELCDYPQNVECPWEHTPPSGPNAGPSGIS
CESNGRCLGQREGILFPSLTSCSGYVVCQCECEVPMECGQGLYWDQKLSTCNYADKVDCS
L
Download sequence
Identical sequences B4LHV1
7244.FBpp0225823 XP_002048334.1.90633 FBpp0225823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]