SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225824 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225824
Domain Number 1 Region: 353-416
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000017
Family Tachycitin 0.01
Further Details:      
 
Domain Number 2 Region: 84-132
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000167
Family Antifungal peptide scarabaecin 0.052
Further Details:      
 
Domain Number 3 Region: 298-353
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000262
Family Tachycitin 0.017
Further Details:      
 
Domain Number 4 Region: 427-481
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000314
Family Tachycitin 0.021
Further Details:      
 
Domain Number 5 Region: 189-248
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000602
Family Antifungal peptide scarabaecin 0.074
Further Details:      
 
Domain Number 6 Region: 244-301
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000107
Family Tachycitin 0.078
Further Details:      
 
Domain Number 7 Region: 136-193
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000112
Family Antifungal peptide scarabaecin 0.074
Further Details:      
 
Domain Number 8 Region: 32-83
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000314
Family Tachycitin 0.085
Further Details:      
 
Weak hits

Sequence:  FBpp0225824
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0123
Family Tachycitin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225824   Gene: FBgn0198665   Transcript: FBtr0227332
Sequence length 483
Comment type=protein; loc=scaffold_13049:complement(21093676..21095045,21096090..21096171); ID=FBpp0225824; name=Dvir\GJ11407-PA; parent=FBgn0198665,FBtr0227332; dbxref=FlyBase:FBpp0225824,FlyBase_Annotation_IDs:GJ11407-PA,GB_protein:EDW70675,REFSEQ:XP_002048333,FlyMine:FBpp0225824; MD5=32d609719c6f295db001fa2f644e3297; length=483; release=r1.2; species=Dvir;
Sequence
MGQFVRQKCASGAYFDTTIKACVVDTEALADDCCQSGDTKADEDDCTKYYACCTGQFVHK
SCPSGEYWNSQSASCETDNGQCVPCTCTEGETQSDPEDCTKYLICKNGEFVSASCDSGDY
WNSQSGKCEKDNGQCIPCTCTEGETQTDSTDCTKYLICKNGAFVSASCDSGDYWNSQSGK
CEKDNGQCIPCTCTEGETQTDSTDCTKYLICKNGAFVSASCDSGDYWNSQSGKCEKDNGQ
CVPQTCTEGETKANPTDCTKYQVCKDGAFVSASCDSGDYWNSQSGKCEKDNGQCVPTTCT
DGEIEVNPADCAGYFECVDGTMVRRKCASQTYFDTNLKACVIDTDGVCIPKVCDPECCDV
PNDWIGPVDKNCSAFIHCLYGHLILQTCPNNLQFNNLTKECDYPDVVKCDDGSPPPSGPT
AGPSGTYCESGGRCVGQRDGTMFAVDNSGGYIVCQCECEINFTCSPGLVFNEQIRSCDWP
AKR
Download sequence
Identical sequences 7244.FBpp0225824 FBpp0225824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]