SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225825 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225825
Domain Number 1 Region: 442-495
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000144
Family Tachycitin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225825   Gene: FBgn0198666   Transcript: FBtr0227333
Sequence length 497
Comment type=protein; loc=scaffold_13049:complement(21087981..21089458,21089518..21089533); ID=FBpp0225825; name=Dvir\GJ11408-PA; parent=FBgn0198666,FBtr0227333; dbxref=FlyBase:FBpp0225825,FlyBase_Annotation_IDs:GJ11408-PA,GB_protein:EDW70673,REFSEQ:XP_002048331,FlyMine:FBpp0225825; MD5=acfaa2f72eeaf05181896109a7032e66; length=497; release=r1.2; species=Dvir;
Sequence
MRNLYALTLLLIAVSASSILGANLDSRQYVPLSVSARDAGTPCLTTTPPCVNTRPPCSGN
AQPTTTTPSVTTKPPCTEEEDKTTTTPCSTTTTTTTTTTTTTTKTTTPTTTTTTTTTTKT
TTTTTTTTTTTTSTTTTKTTTTATTTCSTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTKP
TTTTTTTCSTTTTTTTTTTTTTTTTTTTTTTKTTTTTTTTCSTTTTTTTTTTTTTTTTTT
TTCSTTTTTTTTTTTTTTTTTTTTTTTTTTCSTTTSTTTTTTTTTTTTTCSTTTSTTTTT
TTTTTTTTTTTTTTTTTTTCSTTTSTTTTTTTTTTCSTTTSTTTTTKTTTTTTTTTTCST
TTTTTECITTTPKTTTCSTTITVTTDCNTTTPPCTTTTKCPGGAAATKAKQPFRARPSFR
PLKEVTQLMNGVSSTDDQIQFICVGKPNGFLLASPTRCNDYYICRHQQPLKVSCGDKYFN
GQKGICDLPENTGCVQH
Download sequence
Identical sequences B4LHU8
XP_002048331.1.90633 7244.FBpp0225825 FBpp0225825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]