SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225827 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225827
Domain Number 1 Region: 8-76
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000392
Family Tachycitin 0.01
Further Details:      
 
Domain Number 2 Region: 486-555
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000115
Family Tachycitin 0.014
Further Details:      
 
Domain Number 3 Region: 72-138
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000471
Family Tachycitin 0.017
Further Details:      
 
Domain Number 4 Region: 314-374
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000131
Family Tachycitin 0.042
Further Details:      
 
Domain Number 5 Region: 573-632
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000123
Family Tachycitin 0.042
Further Details:      
 
Domain Number 6 Region: 148-217
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000392
Family Antifungal peptide scarabaecin 0.069
Further Details:      
 
Domain Number 7 Region: 221-293
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000575
Family Tachycitin 0.078
Further Details:      
 
Domain Number 8 Region: 384-449
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000068
Family Tachycitin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225827   Gene: FBgn0198668   Transcript: FBtr0227335
Sequence length 648
Comment type=protein; loc=scaffold_13049:complement(21085520..21087466); ID=FBpp0225827; name=Dvir\GJ11410-PA; parent=FBgn0198668,FBtr0227335; dbxref=FlyBase:FBpp0225827,FlyBase_Annotation_IDs:GJ11410-PA,GB_protein:EDW70672,REFSEQ:XP_002048330,FlyMine:FBpp0225827; MD5=ea66389841e093a2778fc236feb2e65f; length=648; release=r1.2; species=Dvir;
Sequence
MLFGSTPLFDSTFCEHLPTGYYEYPYDCAAYISCRDSRTELEYCATGKLFNKDLQICDTP
DAVDCIESQQPTTTTPDECMDVANGTVMPSVEHCDEFIVCINQQAVIHKCSEPYLFNPAL
HICDDPNEVVCYDGQSTSKATTEAPRPTTEAHNECQGQESGISFPYVEDCHEYILCLGDD
QSVKAKCPVNSWYDPKSGNCGPNVPPTACLEVETTSTTSSTTLSPHQLCADQEFGISYPL
VTNCKQYIVCLGNGESAVVDCIYNAWYNPVTGDCGQDVSPTACQEGSIPTTTTAPTTPAT
TQAPTTPTPTTDEPTSELCSGLLHGQYVSYPDNCSKYVVCSEPVPIAFYCTHGYYFSEAL
QQCVDWDESDCETTGSTVLPPSPTPAPGVCLNNAGSTFPYPENCQWYFRCVNDNVYMMGV
CISGEYYDPFSGECGSNVSPDACQENYSTATTDLSTTTTEMTTISTTISTTDLTTTTTPI
TTVSTTTAPQSDPCEGVPVGDLVPYPNDCTKFIQCNRPNPVVFDCVEGQEFSAQLKRCMA
PWFANCTIAPTTEAPLTSTTELPDIQTTEANPSTHDFCKGKTDGSLVPYPSNCSKYIVCQ
EPIAVGYACPDDEEFSPTELRCMDAQLANCTSIANYYDYNIVSEDSQL
Download sequence
Identical sequences B4LHU7
7244.FBpp0225827 FBpp0225827 XP_002048330.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]