SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225828 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225828
Domain Number 1 Region: 387-446
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000968
Family Tachycitin 0.012
Further Details:      
 
Domain Number 2 Region: 511-573
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000262
Family Tachycitin 0.042
Further Details:      
 
Domain Number 3 Region: 751-803
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000183
Family Antifungal peptide scarabaecin 0.074
Further Details:      
 
Domain Number 4 Region: 909-971
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000191
Family Tachycitin 0.03
Further Details:      
 
Domain Number 5 Region: 444-496
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000628
Family Tachycitin 0.032
Further Details:      
 
Domain Number 6 Region: 572-627
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000968
Family Tachycitin 0.015
Further Details:      
 
Domain Number 7 Region: 325-390
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000102
Family Tachycitin 0.022
Further Details:      
 
Domain Number 8 Region: 272-317
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000471
Family Tachycitin 0.018
Further Details:      
 
Domain Number 9 Region: 685-731
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000732
Family Tachycitin 0.019
Further Details:      
 
Domain Number 10 Region: 804-856
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000217
Family Tachycitin 0.072
Further Details:      
 
Domain Number 11 Region: 856-911
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000128
Family Tachycitin 0.018
Further Details:      
 
Domain Number 12 Region: 1323-1374
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000212
Family Tachycitin 0.021
Further Details:      
 
Domain Number 13 Region: 1264-1320
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000693
Family Tachycitin 0.073
Further Details:      
 
Weak hits

Sequence:  FBpp0225828
Domain Number - Region: 1081-1145
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000275
Family Tachycitin 0.096
Further Details:      
 
Domain Number - Region: 966-1015
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00102
Family Tachycitin 0.029
Further Details:      
 
Domain Number - Region: 1148-1205
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0034
Family Tachycitin 0.049
Further Details:      
 
Domain Number - Region: 1219-1257
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00484
Family Tachycitin 0.068
Further Details:      
 
Domain Number - Region: 1500-1550
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0209
Family Antifungal peptide scarabaecin 0.088
Further Details:      
 
Domain Number - Region: 1385-1437
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0288
Family Tachycitin 0.06
Further Details:      
 
Domain Number - Region: 1024-1078
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0523
Family Tachycitin 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225828   Gene: FBgn0198669   Transcript: FBtr0227336
Sequence length 1579
Comment type=protein; loc=scaffold_13049:complement(21072871..21073668,21073729..21073917,21073984..21074154,21074218..21074406,21074467..21074634,21074703..21074882,21074954..21075118,21075184..21077082,21077158..21077423,21078033..21078740,21078820..21078826); ID=FBpp0225828; name=Dvir\GJ11411-PA; parent=FBgn0198669,FBtr0227336; dbxref=FlyBase:FBpp0225828,FlyBase_Annotation_IDs:GJ11411-PA,GB_protein:EDW70668,REFSEQ:XP_002048326,FlyMine:FBpp0225828; MD5=48c281db9826ff834a7dce7532c9b390; length=1579; release=r1.2; species=Dvir;
Sequence
MKLVSWIFIALQLLLLTTALNARRCVKPSPATTTPTAPSSTQPTTTQSTPTDSGSTGTRS
TLTTALPTDASPTTSDPTLSTEDPGTPTELPQTPTDVGPTEVPKTSTQGTPTDLTQTPTD
VGPTEVPKTSTQGTPTDLTQTPTDVGPTEVPRTSTQSTPTELPQTPTDIGPTEVPRTSTQ
STATDETDTAETTTKATTLSTLLTPTTTEIYVDANSMCKMHPGVEYLPHPYDCHQFIQFT
LLAVVTLTAVASLAGAADPECVYRKLRGLSPHWPNPSSCSSYYRCSTKNTVRSINCPTGK
EYNSKTGKCSTAGRGLCKLSLAAPLADAANICADEVNGAYLLKTGYCKDFYICDQQLAYA
QACDAGSYFDIQTNGCVPDPDAECWQNKCVDKENGEFLPSNTSCASYYVCRDQEATLQSC
ASGTYFDTTLLACVVDENNSQCWENFCIGKPDGSAVADEDDCTIFYMCSGQKATAQECPT
GSYFDVSGPHCIPGTCPDKNSTTTTTLAPPSECDCADGSSHGELVPNPDNCRLYFKCLNG
ELVPGDCQRGNYFDPEIRVCVIDSNNCCPDSSTSDCVDGDVTDNAENCNQYYECENGNWQ
SKTCPSGSYFDIDLSTCVIDVDNVCPQCDTGSDSDSGSGSGSGSDSGSGSGSGSGNDTVI
VTPSVPGRETPIVVGGECKDIKAAVAADNCWSYVACISGIWKKESCIGGFYFDASVGICR
TDDNNLCPENKLLQPNSRSKRAADSDCTCPNGMAEGSMVAHPTDCDKYQLCHDGELIDGT
CGQGNIFSNSEGACVPDTDATCWICRNRPNGYQMIDPADCTSYVTCSDGLAVPATCPTGE
WFDGSACRIDVTGQCINPCSCGSGNVAHPICSKYYHCTDGVPQVVDCAVGEGFDSATGKC
SSKVSCSANLCATADNNAAFPVADDDTKFYLCLDNVATIRSCPADAIFDPTLLICLAQPS
SSCDQSVCTKNTLNQAYPSLTCDNSTFCLCESDGAYLQNCPSGYTFDETLEICTFTGPCD
PLACQGKDEYSVSVNYDDPDSFCVCRVNQPIPVPCPIGYSFNGTLLLCVLAPQPDPRCCR
NYCVGKTDGDTFPALNSETGFCYCLSEVPTFSECPPGKTYDDSLGICLDSAADNSCICNE
CDSTTCADNIIPNIVFPAKSTVDGFCTCKDFCAEYTLCPTGKEFDTELLICLETGPEVCD
ATQCDTLAENQPYEASNGTLGFCYCQGGIPNYSLCPDGKVFDAVLEICLESNCLSSQYCD
SDKCSCLQEYDTFPSSNEEDDTSFCVCINGTAIYRNCDNGKVYNATEGICELIEAPSTVC
TKGKCAKLADHSTYAALNTISGFCLCIEGIAIFESCPVGKEYNATLELCLEPDTKTNLKM
ACDASQCNNLAELTTFAARDSVNGFCTCQAVGVATYQSCGEFHIFDQTFNVCVVDACDPA
LCRTRNKFDTFAARNTTKGFCSCDIVPTYYHCSAGHIFDVNTGVCVDEVTATVAACDPRD
CLNRAQFEAFAAKNTSEGFCSCDGKAEVVTYHKCTDGKLFDRNLNMCLIKEHGIRKRSVE
PEEKVRSLSFLKKFFQKLA
Download sequence
Identical sequences FBpp0225828 7244.FBpp0225828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]