SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225829 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225829
Domain Number 1 Region: 539-590
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000654
Family Tachycitin 0.025
Further Details:      
 
Domain Number 2 Region: 771-826
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000366
Family Tachycitin 0.073
Further Details:      
 
Domain Number 3 Region: 317-373
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000418
Family Tachycitin 0.021
Further Details:      
 
Domain Number 4 Region: 612-663
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000654
Family Tachycitin 0.013
Further Details:      
 
Domain Number 5 Region: 142-195
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000968
Family Tachycitin 0.035
Further Details:      
 
Domain Number 6 Region: 459-509
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000141
Family Tachycitin 0.017
Further Details:      
 
Domain Number 7 Region: 7-68
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000262
Family Tachycitin 0.049
Further Details:      
 
Domain Number 8 Region: 378-450
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000654
Family Tachycitin 0.031
Further Details:      
 
Domain Number 9 Region: 703-756
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000889
Family Tachycitin 0.035
Further Details:      
 
Domain Number 10 Region: 84-121
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000139
Family Tachycitin 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0225829
Domain Number - Region: 204-244
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00034
Family Tachycitin 0.068
Further Details:      
 
Domain Number - Region: 270-312
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000915
Family Tachycitin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225829   Gene: FBgn0198670   Transcript: FBtr0227337
Sequence length 837
Comment type=protein; loc=scaffold_13049:complement(21069925..21072438); ID=FBpp0225829; name=Dvir\GJ11412-PA; parent=FBgn0198670,FBtr0227337; dbxref=FlyBase:FBpp0225829,FlyBase_Annotation_IDs:GJ11412-PA,GB_protein:EDW70667,REFSEQ:XP_002048325,FlyMine:FBpp0225829; MD5=6fedbcdd7f3757cc0d0197dc0b155d20; length=837; release=r1.2; species=Dvir;
Sequence
MSTISLQFVCEVNMKRSVPANCSQYEICLDGNWRRRTCSEARYYNPEQQLCLEPRDDMVC
SYARVPGLPPCGPSTESETIPTTDDKGNCLQYFRCAAGKWRLRSCPRRHYYAAHLNTCLP
MPEFEGEDFCGWFNRSETKVKVECQHLTVRPYPNGCDKFLMCMENSWWIQQCPLGMYFSR
VANYCLPNDANQCRLNVSQVESTGCLHGQKRALATSCHLYEQCVNGRWIGKSCGQSDQFE
PLLGCVANDGSCQGSGLRRSCQQGELRALPLPDINCTQFFYHCDADEWHLGSCLRGQSYA
RQLNKCQPLAKCQAQTTSSSSSSCVGQPDGQSVAHAEDCTRFYLCLQEQPALLQSCASGS
FFDASLGYCRPNDGSCQQIESLCVNNTSGGLIAHAHNCRAYYNCSSHTPNANSSSSSGHN
AVQLLYCPTGEYFNKQLAQCRPDQGQCLQKSLPDSLASLDLCKKTAHGTRLPHQLYCNQY
YACVHGLAILAECESKMRFNATVGRCEPEPSSESDVRATQLCQRGKLDESGNNSALFSCD
SLQDGSYVADYRNCTRYYICAGGVPLVQRCGAGAYFDAEQLLCTPDDGSCPYVITEGNQN
ATNTSLGSDHEPPNPVLCEGKHGHLLPDLANCNNFYICVSNKMRCERCYAGYFFNATLQQ
CQSFELTTDEELDGQAKNPELKTELMESKLADSQPAEKCSDAPTDFANLCEVIGEGASIA
EPGDCRRYISCDEDEPISQRCRNGESYDSLLGICRQNDGTCLMENGERVGVCNGRHGQLA
RDTQNCRGYFVCLHGQKIEAECEAGQFFSKATSTCELDILQQCSNNSNELGKSKSEE
Download sequence
Identical sequences FBpp0225829 7244.FBpp0225829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]