SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225844 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225844
Domain Number 1 Region: 256-357
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.6e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00046
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000445
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 91-147
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000759
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225844   Gene: FBgn0198685   Transcript: FBtr0227352
Sequence length 988
Comment type=protein; loc=scaffold_13049:complement(20554577..20556022,20556082..20556680,20556743..20557078,20557147..20557363,20557440..20557621,20557683..20557831,20560691..20560728); ID=FBpp0225844; name=Dvir\GJ11427-PA; parent=FBgn0198685,FBtr0227352; dbxref=FlyBase:FBpp0225844,FlyBase_Annotation_IDs:GJ11427-PA,GB_protein:EDW70635,REFSEQ:XP_002048293,FlyMine:FBpp0225844; MD5=40d6b8d72daf24265309bdd21f96695e; length=988; release=r1.2; species=Dvir;
Sequence
MDDESDDKDDTKRRSRNLSEKKRRDQFNSLVNDLSGLITTSNRKMDKSTVLKSTISFLRH
HNEATDRSKVFEIEQEWKPTFLTNDEFSHLMLESLDAFMVVFNSVGSVFYASESVASQLG
YMPCELYSKNFYDVTYELDQEALLNVFLNPAPVVEPHQTDIGASNQITFYTHLKRGGHEN
RDASLYELVKFVGYFRIDDNSNANASPDSQQTLPRILQQHPGVELDKRLVFVGTGRIQTP
QMIREMSIVEPNGTEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGYDYYHFDDLDN
IVACHEELRQTGEGKSCYYRFLTKGQQYIWLQTDYYVSYHQYSSKPDYVVCTHKVISYTD
MLNGDSGEQHTPSQAPKSNSSSSKCASATTTLRDMELSSQHLDSHLLDNMLANLNSEQTA
AAASPTMDSSPMWSSSVAPAASSSTLNPLKTSRPASSYGNISSTGISPKAKRKCYFNYNS
RGNESDSTSMSTDSVTSRQSLMTHCSSQSHRQRSHLHHNQRHHSQQQQQHSNFHQQQQQQ
QQQQQQLQLHQSIGQPKILPMLPLAPAQLVTGSACQLTQSSYPLSTPQLMTPSFLEPPQY
LAAIPVQPVMGPFPVAPVLSPLPVPVSVPVSVQGQQPELLSGAVVMTTTQSQLQDQLQRK
HDELQKLIMQQQDELRIVSEQLLLARYTYLQPVMPVSFATTNMTAAGTPVQRNLTFRGSN
AVEPQFNQYGFALNTEQMLNQQDQQMLMRQQQNLHSQQQHNHNLQQQQQLQQQLQLQQTH
QHQQQQHRQQLQLQHSLQQQQQQQQLQQQQQLQQQQLQLQHQSSMLSREDMEDIDAFLNL
SPLQTLDTQLNSNCNGSNNNSNAPQNTNEDSLLSYMQLATESSPSLNFPMGMSDDGSETH
SEDNQMMHSTAHQQHLLQQQQQQQQQQQQQLLQPQQTSSFFATNPFQSISGNENQSHLPN
DLEILPYQMSQEQSQNLFDSPHAAGKTQ
Download sequence
Identical sequences B4LHC2
7244.FBpp0225844 FBpp0225844 XP_002048293.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]