SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225865 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225865
Domain Number 1 Region: 127-187
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000157
Family Tachycitin 0.0075
Further Details:      
 
Domain Number 2 Region: 21-84
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000228
Family Tachycitin 0.032
Further Details:      
 
Domain Number 3 Region: 191-248
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000228
Family Tachycitin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225865   Gene: FBgn0198706   Transcript: FBtr0227373
Sequence length 252
Comment type=protein; loc=scaffold_13049:complement(20298317..20298520,20298577..20299131); ID=FBpp0225865; name=Dvir\GJ11448-PA; parent=FBgn0198706,FBtr0227373; dbxref=FlyBase:FBpp0225865,FlyBase_Annotation_IDs:GJ11448-PA,GB_protein:EDW70595,REFSEQ:XP_002048253,FlyMine:FBpp0225865; MD5=b3101b3d08efd601753877692937bee0; length=252; release=r1.2; species=Dvir;
Sequence
MFKSSLLFALVFIFWPHVNADTFEECSDADAESFVSSYESCQAYVYCDGDDSILGQCDDG
QYFDPESGTCDDAANVSCFLDEVDEPPVEEQPEEPAVQPTEEPEPTPPTMETPAQVEVVN
VAPIVKPSCPQSDDPSQVIFMANNESCTDYYLCYHGHAMQMQCTNQLHFNPITGQCDYPE
NVHCALDEPAAHKCLPHMTDFFPHPDKCSYFYYCIKGFLTLQQCPFYYGWDIERRSCVQL
NVAKCYGSSRRA
Download sequence
Identical sequences A0A0Q9WVN2
7244.FBpp0225865 XP_015030494.1.90633 FBpp0225865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]