SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225866 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225866
Domain Number 1 Region: 175-221
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000942
Family Tachycitin 0.023
Further Details:      
 
Domain Number 2 Region: 2-35
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000228
Family Tachycitin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225866   Gene: FBgn0198707   Transcript: FBtr0227374
Sequence length 228
Comment type=protein; loc=scaffold_13049:complement(20296756..20297330,20297558..20297669); ID=FBpp0225866; name=Dvir\GJ11449-PA; parent=FBgn0198707,FBtr0227374; dbxref=FlyBase:FBpp0225866,FlyBase_Annotation_IDs:GJ11449-PA,GB_protein:EDW70594,REFSEQ:XP_002048252,FlyMine:FBpp0225866; MD5=89609a87ab9854b80ec8be1df93036fb; length=228; release=r1.2; species=Dvir;
Sequence
MYPGNCNYYYYCVDGFLIVEQCPIGYAYNELGGTCSGLLTIVIGCLLALLGSGSVRAAFL
QECEGVIISRVPNPNPDCSEYVFCNGADSYYCNGDCTEPVSCYGSNETEATMSPDSTELA
TEQPAASSTETSRATTGSSSSSSSSSSKSSTLSSTRSTTSLPSTTTTNTSSLQVICRRSG
QNGVYPYPANNNYYYQCIAGYLLLQQCPQHFHFDVALSQCTGSNPYQL
Download sequence
Identical sequences FBpp0225866 7244.FBpp0225866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]