SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225867 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225867
Domain Number 1 Region: 144-206
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000628
Family Tachycitin 0.017
Further Details:      
 
Domain Number 2 Region: 213-267
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000863
Family Tachycitin 0.035
Further Details:      
 
Domain Number 3 Region: 23-84
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000144
Family Tachycitin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225867   Gene: FBgn0198708   Transcript: FBtr0227375
Sequence length 271
Comment type=protein; loc=scaffold_13049:complement(20295692..20295898,20295963..20296571); ID=FBpp0225867; name=Dvir\GJ11450-PA; parent=FBgn0198708,FBtr0227375; dbxref=FlyBase:FBpp0225867,FlyBase_Annotation_IDs:GJ11450-PA,GB_protein:EDW70593,REFSEQ:XP_002048251,FlyMine:FBpp0225867; MD5=9e47ac4c592d971054cdf8580dba2411; length=271; release=r1.2; species=Dvir;
Sequence
MHHPSVKSLLLLLVASCHLAASDIFEQCNAENNNNFVESNTSCTHFVFCSGEDSFEGECP
EENDYFNAQLGMCEPMQDVDCRTGLPLQAAEAAGSITVTELPAVTVTVVVTAAPASSLAT
STASAELQTTPVSLGENKVVTLVASACPATDNYNQIVLLGHDKSCTEYFICYHGKPLAMT
CAAMLHFNVKTGKCDKAEIVNCLRSTISVREQCKSHTVDIYPHPDNCNYFYFCRNGYLML
QQCPFFYGWDYEKRSCVAIAHARCYGRTRLY
Download sequence
Identical sequences B4LH80
FBpp0225867 7244.FBpp0225867 XP_002048251.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]