SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225868 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225868
Domain Number 1 Region: 40-101
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 4.18e-16
Family Tachycitin 0.012
Further Details:      
 
Domain Number 2 Region: 139-191
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000157
Family Tachycitin 0.0058
Further Details:      
 
Domain Number 3 Region: 207-263
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000199
Family Tachycitin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225868   Gene: FBgn0198709   Transcript: FBtr0227376
Sequence length 268
Comment type=protein; loc=scaffold_13049:complement(20293745..20294526,20294585..20294609); ID=FBpp0225868; name=Dvir\GJ11451-PA; parent=FBgn0198709,FBtr0227376; dbxref=FlyBase:FBpp0225868,FlyBase_Annotation_IDs:GJ11451-PA,GB_protein:EDW70592,REFSEQ:XP_002048250,FlyMine:FBpp0225868; MD5=9b2043aa7ca1659f7770053ffa9a4fca; length=268; release=r1.2; species=Dvir;
Sequence
MEYNWKLLDICLLLLCTTLSTSRMQWSIRKPTNSVTIRQSAVSMCLNHASGSFVEHPDDC
RMFYLCQDNGDAVLASCPSNMYYNKVNKICDTADNVKCKNSSSSEISNAPDTGENELNNM
VTDAATYCATLTPQAGTDRIVYIGSSSSCNNYYICYYGQAILQECSVELHWNAVTAKCDL
PERAKCTLEENTVPVQPPGDIASELLHCPAYGQHLYPHMQRCEFFIYCVKGHATLQQCPF
YYFFDVITKTCQWSRTALCVRDLNFPRH
Download sequence
Identical sequences B4LH79
7244.FBpp0225868 FBpp0225868 XP_002048250.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]