SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225964 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225964
Domain Number 1 Region: 145-210
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000575
Family Tachycitin 0.024
Further Details:      
 
Domain Number 2 Region: 31-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000602
Family Tachycitin 0.042
Further Details:      
 
Domain Number 3 Region: 88-136
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000251
Family Tachycitin 0.016
Further Details:      
 
Domain Number 4 Region: 213-280
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000228
Family Tachycitin 0.058
Further Details:      
 
Domain Number 5 Region: 294-336
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000994
Family Tachycitin 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225964   Gene: FBgn0198805   Transcript: FBtr0227472
Sequence length 349
Comment type=protein; loc=scaffold_13049:complement(18493637..18494686); ID=FBpp0225964; name=Dvir\GJ11547-PA; parent=FBgn0198805,FBtr0227472; dbxref=FlyBase:FBpp0225964,FlyBase_Annotation_IDs:GJ11547-PA,GB_protein:EDW70409,REFSEQ:XP_002048067,FlyMine:FBpp0225964; MD5=12083f8b1ed560b042b02ce88905b1df; length=349; release=r1.2; species=Dvir;
Sequence
MRFVDSSVWLILLGLGLILPTCLASSFDPELICTLVVNGTKINDPRVCNGWIQCVDGKSV
SGTCDDGLFYDRQTEDCVPSADTNCISSDPCAAQPNGFAADPYSCNGYYYCKQGVGTRGV
CNNGLNYNPGTESCIRDFPCTAKMNPDSYCNILPDGVFAKDTLNCNGWQMCWKGEVINGT
CPATFYFSAAKGDCDYPQNVECAITEPPPLTAAPEACPKAGSFISDESSCNGYYYCRESS
DGQMLLQHGECDDGRFFSARDGGACVPRSKLQCDYDRCVDLGYTGIQLANESNDGCTGFS
ICQDGVKIGEGTCPNGDYFDELSQRCTNQVISYPACALSSQSTTQTTEA
Download sequence
Identical sequences FBpp0225964 7244.FBpp0225964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]