SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225965 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225965
Domain Number 1 Region: 86-144
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000152
Family Tachycitin 0.022
Further Details:      
 
Domain Number 2 Region: 143-205
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000863
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 26-80
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000445
Family Tachycitin 0.054
Further Details:      
 
Domain Number 4 Region: 216-277
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000392
Family Tachycitin 0.035
Further Details:      
 
Domain Number 5 Region: 274-329
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000628
Family Tachycitin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225965   Gene: FBgn0198806   Transcript: FBtr0227473
Sequence length 334
Comment type=protein; loc=scaffold_13049:complement(18484154..18485151,18487913..18487919); ID=FBpp0225965; name=Dvir\GJ11548-PA; parent=FBgn0198806,FBtr0227473; dbxref=FlyBase:FBpp0225965,FlyBase_Annotation_IDs:GJ11548-PA,GB_protein:EDW70407,REFSEQ:XP_002048065,FlyMine:FBpp0225965; MD5=2dd9d3d39b70013fa10a5fc111471589; length=334; release=r1.2; species=Dvir;
Sequence
MVTSLRVGIGVILLAICLPQPLHALHDFAGMCRLFKNGTHIRKPGTCDEYIECINDTGVI
HTCADSLVFEPSSQKCVQATASNSVYCGNLCEGLDGKWVADPTDCQNYFYCRNGEALGGH
CDNSQHFNETTQSCEYGVDSLCVDVANICEILPDKTKFRQENDCNEYYECKSGKHSLKTC
SSTQYFDVEIGGCALKSQVKCTAHSKKNVCVSKSKPISGYQSDGATCRGYFYCADLGAVP
DIDPIWAQCPEGYFFDDINKRCGLPTSVVCTHNRCEGRGTMLVTSSSNNCHNYITCVDGV
EVEENTCHWDHFFDESVQGCSSKIVYDECCDGRD
Download sequence
Identical sequences 7244.FBpp0225965 FBpp0225965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]