SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226201 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226201
Domain Number 1 Region: 117-187,226-314,380-432,460-678
Classification Level Classification E-value
Superfamily Ras GEF 3.27e-97
Family Ras GEF 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226201   Gene: FBgn0199038   Transcript: FBtr0227709
Sequence length 700
Comment type=protein; loc=scaffold_13049:complement(14522870..14523161,14523226..14523428,14523492..14523635,14524313..14525776); ID=FBpp0226201; name=Dvir\GJ11784-PA; parent=FBgn0199038,FBtr0227709; dbxref=FlyBase:FBpp0226201,FlyBase_Annotation_IDs:GJ11784-PA,GB_protein:EDW70023,REFSEQ:XP_002047681,FlyMine:FBpp0226201; MD5=a1bc4fd99605af97d1c2ed5f63cba704; length=700; release=r1.2; species=Dvir;
Sequence
MSSSSNGGINSATNGRSGSTGSANISLNLKAKSGTTTTTTTNTTTTHKTLPDLKTQRSNS
SVGSGIGIGVVAKTLATHRRDSSHVEKSLLPERSLSYGPPQQSKALGLSREPREGHLVYC
EGKLHSGTLQSLIMHMVPTHDYYPEHGYLFAFLLSGRLFIRPYELLAQISSNWEQQQQQQ
AAGGGCDVVDDAVAQPPALSLHLNSASPLTQRKGAAAGGQELELEPKPQQRTLTQRSAQH
CIRLLSEWIEIFPYDFRDERLMQQVRILARKCVYIDNSLGKQVSRILQLLVARLKALEQY
EEFLQTLSNEAIEQQTQGQQQHQQQQQQLHHHQHHLHLHNPFQTFLGSSHVSASGHTTTN
GTATSGGSASSGNSTNSGSNSASSTPQPDEVFGIMDLCPSCEHLAHQLTAIELERLSHIG
PEEFVQAFAKDYQQAKCASATGNAPVDAAAAPGAVSGSLNDMKKTRNLESYVQWFNRLSY
LTASEIVKYPKKKQRVRIIEYWIETARECFNIGNFNSLMAIIAGLNLAPIGRLKKTWSKV
QSAKFSVLEHQMDPTSNFNSYRSTLKAAMWRSEGATEERERIIIPFFSLFVKDLYFLNEG
CSNRLPNNHINFEKCSQLAKQVMEFNEWKKVTCPFEKLPNVIAYLQHSAVLNENTLSIAS
FECEPPENTEEKDRYKTVKAETKQQLMQQLQEQQQQQQHQ
Download sequence
Identical sequences B4LDY0
XP_002047681.1.90633 XP_015030613.1.90633 7244.FBpp0226201 FBpp0226201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]