SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226280 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226280
Domain Number 1 Region: 198-506
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.61e-33
Family NodB-like polysaccharide deacetylase 0.029
Further Details:      
 
Domain Number 2 Region: 151-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 29-98
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000497
Family Tachycitin 0.019
Further Details:      
 
Domain Number 4 Region: 101-136
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000732
Family Tachycitin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226280   Gene: FBgn0199117   Transcript: FBtr0227788
Sequence length 570
Comment type=protein; loc=scaffold_13049:complement(13272211..13273361,13273430..13273579,13273863..13273975,13274403..13274537,13274707..13274818,13276142..13276193); ID=FBpp0226280; name=Dvir\GJ11863-PA; parent=FBgn0199117,FBtr0227788; dbxref=FlyBase:FBpp0226280,FlyBase_Annotation_IDs:GJ11863-PA,GB_protein:EDW69902,REFSEQ:XP_002047560,FlyMine:FBpp0226280; MD5=e49bb82a7c26fc5c23423c4b8ababd6d; length=570; release=r1.2; species=Dvir;
Sequence
MARWWPIVTFLLFCCAAAQHQDKLEGVDVEEVCADRPADEYFRLDTEGDCREVYRCDSAG
EDGSNRLAPIRCAGGLAFDVLRQLCDWKTNVKNCDIDQSKCTRSGLKEIQCPSGLAFDVI
KQTCDWKAKVTNCDEKEKPRKAQPILKTDEPICPDGKLSCGDGECLDKELFCNGKSDCKD
ESDENACSVDEDPNRAPECDPTQCALPDCFCSADGTRIPGGIEPQQVPQMITITFNGAVN
VDNIDLYDDIFNGQHQNPNGCSIKGTFFVSHKYTNYSAVQDLHRRGHEISVFSLTHKDDP
NYWTGGSYDDWLAEMAGSRLIVERFANITDGSIIGMRAPYLRVGGNKQFEMMADQFFVYD
ASITASLGRVPIWPYTLYFRMPHKCNGNAHNCPSRSHPVWEMVMNELDRRDDPTFDESLP
GCHMVDSCSNVASGEQFARLLRHNFNRHYNSNRAPLGLHFHASWLKSKKEYRDELIKFIE
EMLGRNDVFFVTNLQVIQWMQNPTELNSLRDFQEWKEKCDVKGQPYCSLPNACPLTTREL
PGETLRLFTCMECPNNYPWILDPTGDGFSV
Download sequence
Identical sequences FBpp0226280 7244.FBpp0226280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]