SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226606 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0226606
Domain Number - Region: 5-54
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000133
Family Tachycitin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226606   Gene: FBgn0199440   Transcript: FBtr0228114
Sequence length 54
Comment type=protein; loc=scaffold_13049:complement(8224313..8224433,8224496..8224539); ID=FBpp0226606; name=Dvir\GJ12189-PA; parent=FBgn0199440,FBtr0228114; dbxref=FlyBase:FBpp0226606,FlyBase_Annotation_IDs:GJ12189-PA,GB_protein:EDW69318,REFSEQ:XP_002046976,FlyMine:FBpp0226606; MD5=ec10b138757e0bf28971de025431850f; length=54; release=r1.2; species=Dvir;
Sequence
MKGYFRVESDLTCKEYVYCYKISGEYFGWLYYCNTNEYYNSKTTLCETERPDDC
Download sequence
Identical sequences FBpp0226606 7244.FBpp0226606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]