SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226633 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226633
Domain Number 1 Region: 116-174
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000102
Family Tachycitin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226633   Gene: FBgn0199466   Transcript: FBtr0228141
Sequence length 213
Comment type=protein; loc=scaffold_13049:complement(7802327..7802368,7802491..7802685,7802844..7802966,7805132..7805274,7806890..7807028); ID=FBpp0226633; name=Dvir\GJ12216-PA; parent=FBgn0199466,FBtr0228141; dbxref=FlyBase:FBpp0226633,FlyBase_Annotation_IDs:GJ12216-PA,GB_protein:EDW69270,REFSEQ:XP_002046928,FlyMine:FBpp0226633; MD5=cb15a81bedc578eb45109d67c97c9362; length=213; release=r1.2; species=Dvir;
Sequence
MTTPMSTMTMSLLFGNCGGGDGGTSNDDDAVHFLCGAALIYWPPADDSSQQHLHLAASNG
SNYAASSSNIFASCMSIAFVVVFAVLLAGNCVNGQIDGYIAGEDYPIYDAVPKGLSFNCQ
GRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNGTVFNQAVRVCDWWSNVNCAGSEQLYQ
NNDELYRIPERSQQLQQQDEQHQQQQQQQQQHR
Download sequence
Identical sequences FBpp0226633 7244.FBpp0226633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]