SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226637 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226637
Domain Number 1 Region: 123-182
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000523
Family Tachycitin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226637   Gene: FBgn0199470   Transcript: FBtr0228145
Sequence length 898
Comment type=protein; loc=scaffold_13049:complement(7783839..7784705,7784859..7786128,7786192..7786325,7787000..7787114,7787178..7787272,7787329..7787504,7787791..7787830); ID=FBpp0226637; name=Dvir\GJ12220-PA; parent=FBgn0199470,FBtr0228145; dbxref=FlyBase:FBpp0226637,FlyBase_Annotation_IDs:GJ12220-PA,GB_protein:EDW69267,REFSEQ:XP_002046925,FlyMine:FBpp0226637; MD5=415fbc718ad4492eb73dcd35d4ef7cf8; length=898; release=r1.2; species=Dvir;
Sequence
MKRAKRWLFMTATVLLLGLIGSADAALPFKKVSIAKTPASTTSTSTTTTESSEPATEKPE
LPQPTGEGEESKSDNVTLSKNSKLTGIPQIDYIWDPNLPRELRGYNLSSYPFLSTVPPMD
EIHFKCEGLHDGFYASIEYKCQIYHHCVYGIRHDFLCANFTAFDQRTFICHFASDVDCEG
SQKYWNRNDELYMATTTSSTSTTTTEPPPTPPRRRAQRPYHRPYNRRPVDDYYYDESEDE
YYEDRYSRRNPRPRPRKPQLQLDYDDEYEDKQVAEKPLRRNRNRYRDEDELVDEDYDDRR
NRPGARRGKPQPTAGGRGKASPRKPGRVEERRSFNEERVADEPRRAGGRRRSSEKRTTPS
TVAVLDELDEYEKPYGLDQEEAAEEQTPQKVKTTPKPLTEFITPKAAAASVYARPRAPPR
IARPVPVNEKKKYSYPVQKNTATTHAPAGGEQEDDDYYQDREQQEEDYEQPAQPARNAPR
RRTAAPKEQKPTRSTLRKPVTDKKALLDEEDDYEAERQETPRRKRPQASRARAPAADVDF
VDDVDYEERPAPARAQRVRPKPAAPAPRKPAARPRQPIVQEDEEEHVEPASEEQPAQPRV
PPARTKSNSLPLAPAAPAKPLRPASVRVVKRPFLPSRGGSPYLPRGLQPVGVAVRPQLTS
NTRTTDSTPIDMGSTISGVRLLEHGAPLLRGEQPSSDSDGDSEADSDELPAPSPNPPRTT
LPPRSALPTSVTPRRPEPQPVKLNLDELYENDYDVTLNDALDPTLKPLTPLHPHQHQHAN
YQSRAYASAYVAPAASGAYNPFAGHGNSNYQQQASIYQNHAPSSSHASASQSQPQSQSHS
PPNYHSDSYFSSTDIRRRAIVPAQVSRAHRHEYAAGGAVSSTQTGARLAQHYYDEFAY
Download sequence
Identical sequences FBpp0226637 7244.FBpp0226637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]