SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226712 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226712
Domain Number 1 Region: 280-349
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000994
Family Tachycitin 0.022
Further Details:      
 
Domain Number 2 Region: 200-275
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000366
Family Tachycitin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226712   Gene: FBgn0199544   Transcript: FBtr0228220
Sequence length 362
Comment type=protein; loc=scaffold_13049:complement(6474508..6475596); ID=FBpp0226712; name=Dvir\GJ12295-PA; parent=FBgn0199544,FBtr0228220; dbxref=FlyBase:FBpp0226712,FlyBase_Annotation_IDs:GJ12295-PA,GB_protein:EDW69127,REFSEQ:XP_002046785,FlyMine:FBpp0226712; MD5=49262315c9b882cbd2c18f1617d12259; length=362; release=r1.2; species=Dvir;
Sequence
MSAKEMKLFGWLLQLMCLWASAKATCNVCNAVNSMACYSLNQTQACDASGLPTRIPYSCP
DGYVCVSSAAGVRCQPSSSGTGACQDCNKCDFTRTFACTGTNTFALCLGTDAPQNSVGTC
AAGYVCNNRDERICGLDTQVVPTCSYADETTTTTTATTATTATTATTATTATTATTAITA
TTATTAATTTTAATPSTSDASAYCAAVQAQGNYAVGNYTATTCRQYIKCFLLNGSWRGQA
YTCPGSTYFSPSSRLCVTTVPATCYTPLSTTTTTTVAPTTSNPNAYCAKMQAEDYYPVGT
TASTTCRQYIYCFELNGSWKGKLYTCPGSTYYNSSSKTCVTALPATCTSAVASLSLNGVD
LE
Download sequence
Identical sequences FBpp0226712 7244.FBpp0226712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]