SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226864 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226864
Domain Number 1 Region: 243-355
Classification Level Classification E-value
Superfamily SH2 domain 8.62e-20
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226864   Gene: FBgn0199689   Transcript: FBtr0228372
Sequence length 394
Comment type=protein; loc=scaffold_13049:complement(3815119..3815907,3816456..3816752,3826178..3826276); ID=FBpp0226864; name=Dvir\GJ12447-PA; parent=FBgn0199689,FBtr0228372; dbxref=FlyBase:FBpp0226864,FlyBase_Annotation_IDs:GJ12447-PA,GB_protein:EDW68855,REFSEQ:XP_002046513,FlyMine:FBpp0226864; MD5=0e1615c77aa944eec169afa109dc190c; length=394; release=r1.2; species=Dvir;
Sequence
MGRLFQYNRFGATESVNKRKKDTQKKAHDNAKLLRNVINCPSYSDVYGTNAGKNLDLAFN
KCQQWSNKLLPTTEAAPAADAAAAAAAAEEPAQSRTHKVYDSMKNFLQRKLFALPSQKER
VQCEEPTSDYDEQDLLDSSYHADAEEDEEELVANCSCSSSSSPKRVQHNSKSPQKSLLSL
NCWQSSQPSDTSSSSSSEEAPPEDHDESDAGISDCCQLINEHNNSSISSGTRRRSTPRRR
ATARWNSNTDDEEDVESEEEELLQCAWYQPRITAKAAQEHLQSATPGSFLLRRSTPRRFE
LCLRLDHKVKCYAVQCSRSEMYSLKGAKKQFSTLKALITHHSVMAEQLPLTLDMPRERDL
VKSAAVRYADDFEPLESLQLLGILKSLQAKNFEA
Download sequence
Identical sequences B4LCZ4
FBpp0226864 7244.FBpp0226864 XP_002046513.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]