SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226867 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226867
Domain Number 1 Region: 277-379
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-26
Family SH2 domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226867   Gene: FBgn0199692   Transcript: FBtr0228375
Sequence length 419
Comment type=protein; loc=scaffold_13049:complement(3753023..3753247,3753312..3753592,3754382..3754655,3759383..3759659,3759721..3759923); ID=FBpp0226867; name=Dvir\GJ12450-PA; parent=FBgn0199692,FBtr0228375; dbxref=FlyBase:FBpp0226867,FlyBase_Annotation_IDs:GJ12450-PA,GB_protein:EDW68852,REFSEQ:XP_002046510,FlyMine:FBpp0226867; MD5=6aeec6a06aace6859a43389ab0ef3f87; length=419; release=r1.2; species=Dvir;
Sequence
MAMQDIRLRLEPQHSTAAFSNLPAAAAAAAAASNAETTLIETAETTGPATGSPTARPLAQ
LLPELSFSPPTTGGTGPTQQHFYHQHQHHHPHPHPHSHPVQPRASPRHHVEQLQLLHSSH
HAHSHNNGQEQQVPRSPSSEEDNSPTEMNNCRRLVDKPPLVKRLTMGIGLLRGTEDSRPL
VHNTCSSSLNSGSSQTISDGYVNEAICEPDKYVASKFGDSCRQSLTALETATQRLQSELP
NSKKYLRETCSANSSPKLFAANSPLRLDNLSLAEQQELKGAAWYQAGIPREISLEVLSRQ
SPGAFLVRQSSTKPGCFALSLRVPPPSPRVAHYLILRTQRGYKIKGFTKEFSSLRALITH
HSVMPELLPVPLTLPRPAHIRAQTQAYGHGNGSGSGNGGDFEMYGSLNDFRKMMADLNV
Download sequence
Identical sequences B4LCZ1
XP_002046510.1.90633 XP_015030913.1.90633 XP_015030914.1.90633 XP_015030915.1.90633 XP_015030916.1.90633 7244.FBpp0226867 FBpp0226867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]