SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226870 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226870
Domain Number 1 Region: 380-650
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.02e-87
Family Protein kinases, catalytic subunit 0.00000000192
Further Details:      
 
Domain Number 2 Region: 242-353,383-409
Classification Level Classification E-value
Superfamily SH2 domain 4.15e-37
Family SH2 domain 0.00000921
Further Details:      
 
Domain Number 3 Region: 204-247
Classification Level Classification E-value
Superfamily SH3-domain 0.000019
Family SH3-domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226870   Gene: FBgn0199695   Transcript: FBtr0228378
Sequence length 1688
Comment type=protein; loc=scaffold_13049:complement(3698438..3701142,3702312..3702388,3702468..3702588,3702645..3702870,3703135..3703721,3704100..3704515,3704577..3705108,3707749..3707802,3728231..3728579); ID=FBpp0226870; name=Dvir\GJ12453-PA; parent=FBgn0199695,FBtr0228378; dbxref=FlyBase:FBpp0226870,FlyBase_Annotation_IDs:GJ12453-PA,GB_protein:EDW68849,REFSEQ:XP_002046507,FlyMine:FBpp0226870; MD5=26f5bcdab07341705eab41065eeeb357; length=1688; release=r1.2; species=Dvir;
Sequence
MGAQQGKERGSHSSGGGGGGGGGHGGTVSCIGVSSSSPVASGSPHCISGGASVGALSAGS
TLRSSRIKSHQSAGHGGSIGSSGSSGLSAHRSGSNANHKDNRCNPSVGLNIFTEHNGTKH
SSFRGHPGKYHMNLEALLQSRPLPHIPAGSTAAALLADAAELQSQESPVLGAPLGGGVHS
SATSVFESAHRWTSKENLLAPGPEEDDPQLFVALYDFQAGGENQLSLKKGEQVRILSYNK
SGEWCEAHSDSGNVGWVPSNYVTPLNSLEKHSWYHGPISRNAAEYLLSSGINGSFLVRES
ESSPGQRSISLRYEGRVYHYRISEDPDGKVFVTQEAKFNTLAELVHHHSVPHEGHGLITP
LLYPAPKQNKPTVFPLSPEPDEWEICRTDIMMKHKLGGGQYGEVYEAVWKRYGNTVAVKT
LKEDTMALKDFLEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGR
ETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDT
YTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPGIDLTDVYHKL
EKGYRMERPPGCPPEVYDLMRQCWQWDAADRPTFKSIHHALEHMFQESSITEAVERQLNA
TATGSGSQAVAGVATATASASSSASASLSLTPQMVKKCLPSVDHQQQQQQQQQQLASTPM
SETGSTSTKLSTFSSQGKGNVQMRRTTNKQGKQAPAPPKRTSLLSSSRDSTYREEDARNF
IDELNTNGLTRDINNLTQRYDSETDPAADPDTDATGDSLEQSLTAAATPPNKMQHSLHGG
VSGGIGPRSSQQHSSFKRPVMGNRGLETRQSKRSQQHPAAAREPLTPGNGSITTNGNGGT
PVLPAHPITVGALEVMNVKRVVNRYGTLPKVARIGAFLDSLEDSSSSGNSSSNSNTETSA
NGHATPPARAPPTVPVASKQQQAQPAQPQQMIRSNSSGGVTMQNNAAASLNKLQRHRTTT
EGTMMTFSSFRAAGSSSNSPKRGGGGGVAQPALANLEFPPPPLEEFEALPPPPPPPAPES
AVQAIQQHLHAQHSSSNDVSNTAPSVEEASSRFGVSLRKREPSTDSCSSLGTPPEAPPPA
VAAAQPAEKSLNLKEKLITEIKSAGKPAETTVGYANGSAPPAAVVDPVAQLVTELAESMN
LPKQTKLTNGNCNNSSNSNSSNNNNFKAQLKKVEPKKLNAPMPKAEQPSNIIDFKAHLRK
VDKEQPQQPSQVQQSPQQPQQQHSPNANCSMRKDETGNVKKLAANQKTEIKIDVNNSNAD
ADAASAGYGETGTVTDAGKRRSTGSINSLKKLWEQPPPVASGDYASTSIPQAAQTAQLSP
KYGLKAAQPVVNAKLFGIKPPPAAPPPPPPISSTPCTTTTAQSQQAEAAAAAAAAAAAAV
ATKLAATSPTTTAIKTSLSTQLFTDAEGSSSEEQTAADQQAEHMTRSLYDSEQLQYQSNS
NSNSPSSAVNTQPQQQQPPSQSNANNKLNSAGAGQTKPAVPHKPTKLTIYATPIAKIAGI
GVGVGSGGGVGGGADNSLINSTQISRESILELVTLLEGSLKHPVNAISASQWLQLSDKLN
ILQNSCVVFAENESMPPHSKFHFRELVTRVETQSQHLRTAGSKNVQDNERLVGEVGQSLK
QISNALHR
Download sequence
Identical sequences 7244.FBpp0226870 FBpp0226870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]