SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226880 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226880
Domain Number 1 Region: 1022-1090
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000248
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 
Domain Number 2 Region: 933-1009
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000107
Family SAM (sterile alpha motif) domain 0.031
Further Details:      
 
Domain Number 3 Region: 1105-1143
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000868
Family SAM (sterile alpha motif) domain 0.067
Further Details:      
 
Weak hits

Sequence:  FBpp0226880
Domain Number - Region: 249-509
Classification Level Classification E-value
Superfamily Tropomyosin 0.00981
Family Tropomyosin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226880   Gene: FBgn0199705   Transcript: FBtr0228388
Sequence length 1194
Comment type=protein; loc=scaffold_12963:complement(3350335..3350424,3350493..3350609,3350841..3351160,3351227..3351334,3351399..3351601,3351661..3352274,3352629..3353558,3353966..3354094,3354840..3354959,3355023..3355190,3355867..3355974,3356060..3356386,3356452..3356553,3356613..3356861); ID=FBpp0226880; name=Dvir\GJ12463-PA; parent=FBgn0199705,FBtr0228388; dbxref=FlyBase:FBpp0226880,FlyBase_Annotation_IDs:GJ12463-PA,GB_protein:EDW63550,REFSEQ:XP_002051395,FlyMine:FBpp0226880; MD5=d4208a866598fd7d82e0dedd35b832b8; length=1194; release=r1.2; species=Dvir;
Sequence
MWNMMCDVMPTISEDSISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLVETE
GKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLL
EHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLS
IEKNNVLEEELNTTKEELNQYKTGALPAGGINSASNASGENGIKEKLASGGGGGGGGVNG
DASEINEYAAKTHELQTIIEKQTSELSQWQRRVSDLNSKINELEENMSRVQKEHCKAQDQ
CSKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHKEAQLKLH
EEKISAIEEKLELSEQKLAQHAKLQPDMEEQLKARMEALTKAQERHGSAEDRIRALETNL
DEKSAEVVRLNQRLKMNEEHNLRLSSTVDKLLSESNERLEVHLKERMRALDEKNALTQEL
EKARKVAEELHHEKSEIMKELSKTRLEIENFKRQLLQQEIAYNIQQTEALTRSLSPSSVV
DGGGGNAFSRSASHASFETHSLRRQSKSRLSEENALARSMAEQEWEKLQMQQVAHAQAYD
LVSSVADCDDSDALYAAATADMMSPSGHTDAQTLAMMLQEQLDAINNEIRLIQEEKQSTE
ARAEELESRVGSLEHVNLLARGRSMDRQSPPMSGRSTPNSPQRDFMQKYHTLNLPVLSSD
ASREELHGGMSTTGDSSSGGAASPLTARSMRLERVAQALAHSQEELRRRTMAPAASPHVN
AHMTLNTHSYGLSPLSSRYGSQESLRHYNTMGSMSMLQTPTSGVSREAAAAAAVQKKKGI
KSSLGRFFSKKEKVKGVKDTLPDGSPSMMSIGNLSIGLSEVDSNYDVMSMTGGMMPRIAS
APGSKISSVDYGRQKKDHDYRNDLLGEAMKAGTPFALWNGPTIVAWLELWVGMPAWYVAA
CRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPQTSRTTLAFG
DMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYG
ISMLKRLNYDRTELEHRRKMSENGLCDVLVWSNERVIRWVGSIGLKEYANNLLESGVHGG
LMALDEGFDANAMGLALQIPTQNAQARQILDTEFRNLLQIATDRRPDSEQRSAS
Download sequence
Identical sequences FBpp0226880 7244.FBpp0226880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]