SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226899 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226899
Domain Number 1 Region: 400-503
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.93e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 182-240
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000017
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.041
Further Details:      
 
Domain Number 3 Region: 84-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226899   Gene: FBgn0199724   Transcript: FBtr0228407
Sequence length 992
Comment type=protein; loc=scaffold_13049:complement(3103261..3104731,3104795..3104942,3105005..3105111,3105176..3105369,3105897..3105974,3106342..3106463,3106582..3106900,3107044..3107111,3110266..3110501,3114784..3115019); ID=FBpp0226899; name=Dvir\GJ12482-PA; parent=FBgn0199724,FBtr0228407; dbxref=FlyBase:FBpp0226899,FlyBase_Annotation_IDs:GJ12482-PA,GB_protein:EDW68809,REFSEQ:XP_002046467,FlyMine:FBpp0226899; MD5=64ca202e52394e819be26600dd96048a; length=992; release=r1.2; species=Dvir;
Sequence
MLPYQAVAMDYAGYQRQPTPGHPGSHMVGSLGMSAVPFSHSWMVPTQDLCGMPPYNKMPN
QHQPGAPGMHAQQQPIEPGILELRKEKSRDAARSRRGKENYEFYELAKMLPLPAAITSQL
DKASIIRLTISYLKLRDFSGHGDPPWTREASSSSKLKSAAIRRSPAVDLFEQHQGTHILQ
SLDGFALAVAADGRFLYISETVSIYLGLSQVEMTGSSIFDYIHQADHAEIADQLGLSLTS
GAGGGGGGGGGGGGGAGSVSGAAGLASPTSGASDDGSGTHGTNNPDVAASMTQASTSGYK
GYDRSFCIRMKSTLTKRGCHFKSSGYRASDATSNCNGSNNNGKNVKNPASNYSVVLLLCK
LRPQYTFSHTRKSQPPLLGMVALAIALPPPSVHEIRLECDMFVTRVNFDLRVAHCEPRVS
DLLDYTPEDLVNKSLYSLCHAEDANRLRKSHTDLIEKGQVLTGYYRLMNKSGGYTWLQTC
ATVVCSTKNADEQNIICVNYVISNRENENLILDCCQLEPSVDSIKHEEGLGNDKSSGSPG
GDAAGEGNAHLSAGDMKLGLSSPKTLADPEGHTQRSGRGRNASAHGSNLNSLALIKDSPT
PLGVEVEGVLPATVATPVPTPAPAPTTTTTATTTKRKRKSKATQQAEEQQQQADLQQQVD
QQQQQQPLSKLPALEQPHRDAQQPRSRLPSMVDEQPAGADSAVKDLEHAMSKHLPSPSAN
QPSTDFSADALIKHQQHQVQQQQQQQQQQQQLQHDPNEKSSTIQWIGTPYQQPAPMPATA
LLRQLYANRESVIRATARQTPTGVFYGEQQGGPLPTPPGSESSYENQYLQLHSAAAAASV
THAGGQKAPGGNSTDAFTNLVSTYGGYHSSIDYHNAMTPPSSVSPRDSNNSAKAPAAAAP
PPGLLVGSNGGYDYADSLRGQYATPVDGGAPAASLPLKPQAYTAGMHPHATTTTEGGVTY
SNLDQPQYFAPHSSFHLYHKGSPASAWYSTPS
Download sequence
Identical sequences FBpp0226899 7244.FBpp0226899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]