SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0226931 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226931
Domain Number 1 Region: 223-343
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-24
Family SH2 domain 0.00073
Further Details:      
 
Domain Number 2 Region: 636-806
Classification Level Classification E-value
Superfamily Ras GEF 1.29e-22
Family Ras GEF 0.02
Further Details:      
 
Domain Number 3 Region: 45-102
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000157
Family SAM (sterile alpha motif) domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226931   Gene: FBgn0199754   Transcript: FBtr0228439
Sequence length 952
Comment type=protein; loc=scaffold_12963:complement(3304791..3304917,3304980..3305386,3305449..3305883,3306455..3307480,3307731..3308085,3309357..3309525,3309579..3309734,3309801..3309926,3309987..3310044); ID=FBpp0226931; name=Dvir\GJ12514-PA; parent=FBgn0199754,FBtr0228439; dbxref=FlyBase:FBpp0226931,FlyBase_Annotation_IDs:GJ12514-PA,GB_protein:EDW63543,REFSEQ:XP_002051388,FlyMine:FBpp0226931; MD5=17ee921500e19c2a247afc1d39dfe3d5; length=952; release=r1.2; species=Dvir;
Sequence
MGNVQTRQLESRNATNRRSSILWNFRYPQAARRRDDVAMIIHNSRLSIGEWLNLLELQQY
EGNLKMYATVDDVGDITDRDLKRLGIRSMSHRQKMLNSLLGVRAKRRQSMNLEALRSAPC
AVPRRKSSCPMVYLDADNMAGSNDSGGAAVITTKSGKVLKQLTFDETTTIYEELRPRSKC
NSPHWDNNANDMESGNNSNVSTPIAASPNPNEQQEAIALKKALEWELSLDARELRSHAWY
HGALPRQRAEEIVQREGDFLVRDCASQPDNYVLTCRSKSAVLHFVLNKLVLQPETVYERV
QYQFEEDAFDTVPDLITFYVGSGKPISAASGALIQYPCNRTYPLSFYGHKIVGNQLHTQM
LAGLRGLSPLNSPMGNSSAGGSAIFRFGQLAGDVPAQQQATVPAATPASPHCSPPRVRRE
VPPPRLPCKKQQRSQSLTPAQAMVVCNINKQQEQQQQQQQQQQQLAAADATNGHGLARFQ
TIARCNPTIDMQLQSQQLEHKFSTQSLPRPSTSAAQALRQQAAARICNLARNFSLDTPDR
APSPPPKPRKEPMAAVLAYQASGSDSGNGSGDSAPGDVSELSIQRGGVIIKNPRYMSSSA
SNGTLKSFTEFDALAAEEQLFTLPIEEFKLSSKFDFENFSTLLLPSVENKPLDGDALNTF
KMMLLETGPKLLAEHITRIDIGLFLDEPANETDCYLSCSGLELLTLPHGKVFREDLIERT
QCIKLMVAVTILTCQTDLDRAELLSKWIQIAVETKTALGNLFGFCAIMLGLCMQQIQKLD
QAWHILRQKYTDSAFTFEAKLRPTLSSMNEASNPQAPNTTVPHVLLYALLIDRPVLDIIN
HGNVDERPALYNTCIAPWETKADDFGMSINFQHLDASRGFLKNLDLYRKNAKIIMEEAST
RLDELLADAFRTEFHVKFLWGSSGATAKPEDRHGKLEKVLTLMADKFCSVSA
Download sequence
Identical sequences B4LR79
7244.FBpp0226931 XP_002051388.1.90633 FBpp0226931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]