SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227017 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227017
Domain Number 1 Region: 8-64
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000262
Family Tachycitin 0.0094
Further Details:      
 
Domain Number 2 Region: 477-538
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000288
Family Tachycitin 0.012
Further Details:      
 
Domain Number 3 Region: 619-673
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000105
Family Tachycitin 0.015
Further Details:      
 
Domain Number 4 Region: 380-433
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000262
Family Tachycitin 0.035
Further Details:      
 
Domain Number 5 Region: 146-204
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000863
Family Tachycitin 0.068
Further Details:      
 
Domain Number 6 Region: 546-598
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000314
Family Tachycitin 0.096
Further Details:      
 
Domain Number 7 Region: 308-355
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000366
Family Tachycitin 0.044
Further Details:      
 
Domain Number 8 Region: 703-756
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000011
Family Tachycitin 0.067
Further Details:      
 
Domain Number 9 Region: 82-131
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000366
Family Tachycitin 0.064
Further Details:      
 
Domain Number 10 Region: 224-275
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000149
Family Tachycitin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227017   Gene: FBgn0199839   Transcript: FBtr0228525
Sequence length 1399
Comment type=protein; loc=scaffold_13049:complement(1638296..1640154,1640217..1640699,1640760..1641494,1641553..1642020,1642076..1642303,1642453..1642659,1642711..1642930); ID=FBpp0227017; name=Dvir\GJ12600-PA; parent=FBgn0199839,FBtr0228525; dbxref=FlyBase:FBpp0227017,FlyBase_Annotation_IDs:GJ12600-PA,GB_protein:EDW68611,REFSEQ:XP_002046269,FlyMine:FBpp0227017; MD5=e145099efd08065f405ac6d5a2235246; length=1399; release=r1.2; species=Dvir;
Sequence
MQQLNTQPKCAAGLNGLQPHPYDCTKFLNCANGQTFIQNCGPGTAFSPTMLVCDYKHKVD
CGDGRFNVDVSAQGQTGGTSGGLTCPEGARGQFPYPNDPYKYVICGIGVQARLEQCPSGK
IFDGHSLICIPIGALSAQTDFSSTARLSDLLCPGGVEGLFAHPFDQTKFLNCKAGKVAVQ
SCIPGHVFSISKGYCQLKAQTVYSDYVTYIVSEISYEYSLMLTRCPAGTDGLHLYPYDAG
KYVRCEAGGGMSVLSCGEDMAYSFTQRACRPRRQVTRAERVKFFSELSFQGGSYSYTDSQ
AFQSGLKSCPPNLRGNYAYPFHASHFVLCQNGLLQVESCPAGSVYSLSTRRCAARQQLTS
HDFLDYAYINIQLSTDLLLDLTTVTCPANAVGYYLHPFDCTKYLNCRDQQTSIESCEKGE
VFSISQRSCVARDELVAAYDRVEYLTETQHEFSQEHPVAEGREPQFNLQPVNGVVECLSG
AGGLQPHPYDCTKFLNCANGQTFVQDCEPGTAFNRLRSICDHAAQVNCAQSIINPNTYTT
SVASYRLACPVHVYGLYAHPFNAKSYLYCDEGHTTIRQCLPNEVFSLSRGYCLSAELVLA
ADRVSLLSGAEELSLEHLESISCPRDAVGNHAYPFDCTQYLSCEAGITRLQSCPNGQHFS
LSQRRCQPQEQVQRIDRVYQLSELQIFYEWWQQLQHVGASIRIRCPFGLTGNYQHPTLPH
KFINCAAQNSEAVFLDCSAGQVFSVSRRLCVPGTQVPTHDRCDYQSKQALNSYGWIDLRH
DAREPKAYVQPVYGGADQYGSGSGIKTTVVSGGSRWSDMNMARPSGIGFGQDTQQTLANG
WSGQGSSYNRQAPTQSVLYVEGSLQPNRNYQATNTNSIYKTPLAPMAPTTSNVYYAQPVE
TVHSSRQNFSRSQTNDWHTARTPYNPQSSYPQASLPGQQPLDLDYQPDGHAEEPRNQLPS
GSHQEPREHSRPPYSSVPTNHNPTLHGQSYQPAVESNLYGGLQPPTPPAQPSGFTPIHPQ
HNPPAHAQPGQRPLDLDDYNPDVDTQATVDQPYPIVPSVPANHSPTYRGQPHPVANESNL
YGGLQPPSRPSLAETTTTRTTSSTPSNLRTFPIYPRVFDATPANPANHPHYSPPYAAVAH
SQNASWQKVPPRAPESDPFLDRGDYDEADYGDSETTTTERNGLRPPPFNHQFYNPSQGAA
PAAETPSKVALGEALRLMLRPYFNHSGNAQEALAERAESAIASAISKPPTSTTPIPTTTT
TTTTTKVPHRGRQTPDDEVELIVAGEQESLDIADDDSVVPDAVETARTEQTLNPTTYASG
YDTTDFQRGTRRVDTDSSTQSYPHSNSNKPHTWGHSREFHKRHPICPIRSISQKTASHPP
LPPPPPPPPSSTRAQPSLP
Download sequence
Identical sequences FBpp0227017 7244.FBpp0227017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]