SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227126 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227126
Domain Number 1 Region: 755-1001,1071-1122
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.11e-99
Family Type II chitinase 0.000000153
Further Details:      
 
Domain Number 2 Region: 1192-1435,1506-1551
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.77e-96
Family Type II chitinase 0.000000281
Further Details:      
 
Domain Number 3 Region: 1001-1070
Classification Level Classification E-value
Superfamily Chitinase insertion domain 4.84e-25
Family Chitinase insertion domain 0.00026
Further Details:      
 
Domain Number 4 Region: 1431-1501
Classification Level Classification E-value
Superfamily Chitinase insertion domain 2.75e-21
Family Chitinase insertion domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227126   Gene: FBgn0199945   Transcript: FBtr0228634
Sequence length 1609
Comment type=protein; loc=scaffold_13049:complement(140198..140295,140500..140701,140947..141917,141978..142089,142198..142759,142900..143297,143554..144059,146212..146293,169044..169989,170053..170162,170638..170973,171046..171176,172998..173373); ID=FBpp0227126; name=Dvir\GJ12709-PA; parent=FBgn0199945,FBtr0228634; dbxref=FlyBase:FBpp0227126,FlyBase_Annotation_IDs:GJ12709-PA,GB_protein:EDW68440,REFSEQ:XP_002046098,FlyMine:FBpp0227126; MD5=5f955c05c1b7f167e8840f4486f97010; length=1609; release=r1.2; species=Dvir;
Sequence
MPKDSSNYVKSRTKHRKRVASLAICGIRIILFGCALSTLMRPTQAEVKELTAEEVDSVIG
PRSDNANAGEQMGHLHFPSIEYTPFESKANYTEETIYSTAFTDSLHGFTHSLFDKIVVRG
HLIPPGLRSVKRDLSFALAALCGNRDCLNFLKGSNIETLDTSKCLHFDELPVSSKYIHLV
DELIHNDTANIPSDAIYRLQSIGVYIKQAIDPVTPPLIRDLHEGITQFHNQAQNMRNIID
SVISHIHFETLKGTKSLDDVYDKFGVYRKGSNLLICVMLGIVLFLLILALIFGCLGRLRH
SQAVIFCSKGTGAIFLFFAIILIFCVLSAILLVGLFYFVIGLITYQGVCAPLRDETKNAF
FRQMDATIDLQQYFPKNDSNWQPAAPMHISAAIEACEANETIFNLLQRNNLYDVNDLVRI
EVIAAHPTPNGTIFPANVSTYEVLTQQEKDGLNVAAQSNLSDYHSSIFLKHLCKTVAPVD
LPRMIAQLRNLRSGLPSVWGIYDTAIIALGNQAFALEKYNKELADRVRSTLIKLTNKLLE
IDRLILYEDRPFGESIEKLIQLADASEVYLRNSSESLVNALRQNLSLFLEDEVANYIEMV
VNFCNRDVGRCAPLAYIYYRGVDLICHRLVDPMLPPRLLRIVFVICLLIVLLSPSTDSAQ
TKTRRRLRRPTTVSSSSRSNLLTAKKSTAAPVAEKRIDQEPASTTRVTRTRLRSKSKLRG
GAAAAAAAAAGGTALVASGSSLKGKKTKVDDGTPKIVCYYTNWSQYRVKIGKFVPEDIPA
DLCTHIIFAFGWLKKGKLSSYESNDETKDNVPGLYERMMNLRKANPKLKILLAIGGWSFG
TQKFKDMSATRYTRQTFVYSAIPFLRKRGFDGLDMDWEYPKGSDDKKNFVLLLKELREAF
DAEAQELKQPRLLLSAAVPVGPDNVRGGYDVPAIASYLDFINLMAYDFHGKWERETGHNA
PLYAPSSDSEWRKQLSVDNAANLWVKMGAPKEKLIIGMPTYGRSFTLANTDKHGPNAPAT
GGGREGVYTKESGFLAYYEICEMLLNGAVYVWDEEMKVPYMVDGDQWVGFDDERAIRNKM
QWIKTNGFGGAMVWTIDMDDFKGEVCGGNVKYPLIGAMREELLGISRGKEAKDVNWTAIA
ATFEDIEEEKPEPIKISVDEILKKVRKPQTQKKQRIKSGANAIEQNTRPAQVFCYLTSWS
AKRPGAGKFEPDNIDPKLCTHIVYAFATLQDYKLTEATDDDPENYESVIALRDTNPDLQI
LLAIGGWAFGSTPFKELTSNVFRMNQFVYEAIDFLRDYKFNGLDVDWEYPRGAEDRVAYV
NLLRELRVAFEGEAKSSGLPRLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHG
QWERTVGHNSPLFALESATGYQKKLTVDYSAREWVKQGAPKEKLLIGMPTYGRSFELVND
TQFDIGSPSSGGGKAGKFTSEAGFLSYYEVCSFLAADNTTLVWDSEQQVPFAYRGNQWVG
FDDERSLKTKTEWLKEQGFGGIMVWSIDMDDFSGRCGNGKYPLLNALTEELKDYKVTLEY
DGPYESHGPRGAYTTKDRERLRLARERGGLPRANRGACLSDPMWLEKGF
Download sequence
Identical sequences 7244.FBpp0227126 FBpp0227126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]