SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227343 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227343
Domain Number 1 Region: 359-463
Classification Level Classification E-value
Superfamily SH2 domain 7e-26
Family SH2 domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227343   Gene: FBgn0200160   Transcript: FBtr0228851
Sequence length 494
Comment type=protein; loc=scaffold_13049:join(3882468..3882997,3883310..3883412,3890254..3890530,3890589..3890959,3891019..3891222); ID=FBpp0227343; name=Dvir\GJ12926-PA; parent=FBgn0200160,FBtr0228851; dbxref=FlyBase:FBpp0227343,FlyBase_Annotation_IDs:GJ12926-PA,GB_protein:EDW68857,REFSEQ:XP_002046515,FlyMine:FBpp0227343; MD5=43ecb357e010c1ec26fbd953afe89b5f; length=494; release=r1.2; species=Dvir;
Sequence
MPKSDGAMITNNNLDYEKSCLTAATAAAAAVAADAAATIASSNSNSNGSASSSNNSSPTA
DNQNNSNSNSSSHSMNSNNSPSSYFNRFDNRIAANLAAVITGARFRSSSCSSRQQQQQQQ
PPNSHARQVNNGSRSSYHYLSATRGRSTLSNATATPPSPASLGRRRPLHLFTQANLNCNE
NEKVAQTPSSDEDNSPTELNNCKRLTDKPPLVKRLTMGLLRHNEESRPLVANVTPLSAAA
LLKGENSQPIYSNGYINEDSYIDSKFGDSCRQSLTAIPMLDNVNLNDNSEFNLKKRYLRE
TSSANSSPKIFANRLRVNNAAAAAATAAAATLAANQRSSSLANTHNHELEAEEESDMELK
DACWYQAGISRDIAIEVLQSKSPGAFLVRKSSSKPGCYALTLRVPSPPGPKIANYIIQRS
PRGYKIKGFRKEFSSLKALITHHSVMPELLPVPLAMPRPTNMSSSRRNLDDFDTYDSLQM
LLKYLRAKNLETEQ
Download sequence
Identical sequences B4LCZ6
FBpp0227343 XP_002046515.1.90633 7244.FBpp0227343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]