SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227391 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227391
Domain Number 1 Region: 82-244,472-858
Classification Level Classification E-value
Superfamily Cullin repeat-like 6.28e-112
Family Exocyst complex component 0.00042
Further Details:      
 
Weak hits

Sequence:  FBpp0227391
Domain Number - Region: 364-410
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000119
Family SAM (sterile alpha motif) domain 0.027
Further Details:      
 
Domain Number - Region: 10-88
Classification Level Classification E-value
Superfamily Tropomyosin 0.015
Family Tropomyosin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227391   Gene: FBgn0200208   Transcript: FBtr0228899
Sequence length 861
Comment type=protein; loc=scaffold_13049:join(4822488..4822701,4822767..4823281,4823563..4824063,4824329..4824393,4824455..4825185,4825247..4825569,4825635..4825768,4825824..4825926); ID=FBpp0227391; name=Dvir\GJ12974-PA; parent=FBgn0200208,FBtr0228899; dbxref=FlyBase:FBpp0227391,FlyBase_Annotation_IDs:GJ12974-PA,GB_protein:EDW68946,REFSEQ:XP_002046604,FlyMine:FBpp0227391; MD5=d03179b56b930f8ae95b9d1b5d8e21da; length=861; release=r1.2; species=Dvir;
Sequence
MNNLDSSLQAHNKLEKETTNLVLLKDRVDKYHDLSTQMSSILTIFEKRLGNLEQTILPVY
QETEQLQKRQQNLEATLNCLESVLSHYDVSQEVCQLIHQGPIEGNIGAFLDALAKLRAAM
DYFLHNNSQSVELENVTSLFNNGCEGLNQHYSMLLKKHSAPLKPVELLDLIYIEDDSSSD
EFTSFRQLSQSTREELFTISLWLEQNMREYTHIYASERGEVVLRSLQLLKDHQKSSSWGT
EALLPYNRSCDINTLTVDSINVRCSTPIVGKLRSPNLSPIRMDMRLNKSPASPMILKKQV
KKKQQQQQPQLANPVKKPGKEVGPLDDSNNSLNNFLDDSSASNTETSLCRESRRRSLQAE
NHSYVLNHATNVKEVLLLVGLETYLDKFENSHIDLLELVSMQRADLKNIGRPRHSGRQNE
PKKNTSARLQQIFEKKANKLYLRATQTIEQSTGFSIKKASSHSDHLTSEDLLDGDQELDK
YLVMLLGLQRLLNWERAIMRDIIPPSKHNEVFARLAYNAIELVVKDAEAITQRILRCISR
KEWTSALGIFSALKRVILLQPDIERTYDAAQREQLTKVLNKLQQTGAKALEHFLDVVKGE
SSTNIVGQSNVPKDATVHELTSNTIWFIEHLYEHFDVIGSILAQDVLYSTQLDTILMKKA
LPGEERNKALLAIYIKKALAELNLSIMNKCEQYNDQATKHLFRLNNIHYILKSLQRSNLI
DLVTLAEPECEHSYLEMIRELKTSYQKTWSKMLSGIYSLEELPKPVAGKVKDKDRSVLKE
RFSNFNKDFEEACKIQRGISIPDVILREGIKRDNVEHILPNYNRFFEMYAAVQFSKNPDK
YVKYRPHEINAMLSKLFDDSA
Download sequence
Identical sequences 7244.FBpp0227391 FBpp0227391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]