SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227492 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0227492
Domain Number - Region: 186-233
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0162
Family Tachycitin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227492   Gene: FBgn0200303   Transcript: FBtr0229000
Sequence length 245
Comment type=protein; loc=scaffold_13049:join(6475908..6476506,6476569..6476707); ID=FBpp0227492; name=Dvir\GJ13075-PA; parent=FBgn0200303,FBtr0229000; dbxref=FlyBase:FBpp0227492,FlyBase_Annotation_IDs:GJ13075-PA,GB_protein:EDW69128,REFSEQ:XP_002046786,FlyMine:FBpp0227492; MD5=3989922a95e0ab54303b60e78d79cadc; length=245; release=r1.2; species=Dvir;
Sequence
MRHLLTAILAIAFGCQGCQAECNACAVGSNVACISEREFQYCSNHQATGPINSCPAGSYC
TSQLPICQQNAALAACEGCGECNELGTFACMDTRTFALCLGGNRPSNITVNCGEQLVCNR
YLPEICGNATTTSATCPKQLPTTEEPATTEEPATTEQPSTEDNTESTTLESPIESIDDFC
RASFKGIPIHAIPNDTECTSYIYCRFYIQSWVGRIIDCPTDKPYFDGWNLVCGNTKSTLP
GCLFA
Download sequence
Identical sequences FBpp0227492 7244.FBpp0227492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]