SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227493 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227493
Domain Number 1 Region: 154-222
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000188
Family Tachycitin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227493   Gene: FBgn0200304   Transcript: FBtr0229001
Sequence length 239
Comment type=protein; loc=scaffold_13049:join(6477940..6478478,6478535..6478661,6479053..6479106); ID=FBpp0227493; name=Dvir\GJ13076-PA; parent=FBgn0200304,FBtr0229001; dbxref=FlyBase:FBpp0227493,FlyBase_Annotation_IDs:GJ13076-PA,GB_protein:EDW69129,REFSEQ:XP_002046787,FlyMine:FBpp0227493; MD5=6a4662bfb6e62db634a6808ff646b8ae; length=239; release=r1.2; species=Dvir;
Sequence
MLRVLVLLLLAIGVQDCRGDCNICSASSNAACVSETQFMFCEDNLPIQPINSCPSGSYCT
AQEAICQTDSTMRSCNSCFTCNEDMTHACLGVRTFALCLGTFTPSSITGSCAPNYVCNLE
NPNICGSASSGSQATCPLVDDEMSTTLSPGSILDPTTYCRYIQKAGRFPYGNTLETTCKE
YIYCYLSASSWYGALYYCPGSTYFQPTSQMCNTSIPITCTSGISTYFPQSQVELPKTSS
Download sequence
Identical sequences FBpp0227493 7244.FBpp0227493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]