SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227614 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227614
Domain Number 1 Region: 36-503
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.41e-157
Family Family 1 of glycosyl hydrolase 0.00000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227614   Gene: FBgn0200423   Transcript: FBtr0229122
Sequence length 555
Comment type=protein; loc=scaffold_13049:join(8394781..8394854,8395460..8395661,8397137..8398030,8398420..8398917); ID=FBpp0227614; name=Dvir\GJ13197-PA; parent=FBgn0200423,FBtr0229122; dbxref=FlyBase:FBpp0227614,FlyBase_Annotation_IDs:GJ13197-PA,GB_protein:EDW69361,REFSEQ:XP_002047019,FlyMine:FBpp0227614; MD5=fdb1a2c35c7349bc8948e6f384e97d73; length=555; release=r1.2; species=Dvir;
Sequence
MWQMLLKITLLALALEQSSRCAAAATLGSPTSNARHFPNDFLWGVGSSSYQIEGGWNADD
KGESIWDYMTHKNPEKIVDQSNGDITADSYHQWRRDVEMVRELHVTTYRFSLSWPRIMPG
GYMNQVSTAGIKYYSNLIDELLKYNITPMVTIYHWELPQRLQELGGWTNPEIIPLFKDYA
RLVLEMYGDRVKLWTTINEPWHVCEHGYGVDYMAPSYNFPGIPAYLCGHNLLKAHAEVVH
MYREHFQPRQAGRIGITLDTSWPEPRNPDSAEDREASDRAVQFYVGWFAHPIFSKHGNYP
KIMIERIRNLSKQQGFGARSRLPEFTNEEIHRIRGTSDFFGINSYTSNLVTPNGHNNTGK
FPVPSFNHDMGVVESQAGVDWPGSGSFWLKVYPKGMYNLLMWIHREYNGPEIIVTENGVS
DRGGLEDYARVDYHNLYLSAVLDAIEDGANVSGYIAWSLMDSYEWKAGYTEKFGLYHVDF
SAPNRTRTPKISARVFANICKTNAIDWSYRPALDEHQLVVAARLPALETEAAANAAATFS
WSLALLLGVVLAWHS
Download sequence
Identical sequences B4LG53
FBpp0227614 7244.FBpp0227614 XP_002047019.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]