SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227762 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227762
Domain Number 1 Region: 15-185
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-42
Family Phosphotyrosine-binding domain (PTB) 0.0000213
Further Details:      
 
Domain Number 2 Region: 306-405
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-25
Family SH2 domain 0.0000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227762   Gene: FBgn0200570   Transcript: FBtr0229270
Sequence length 418
Comment type=protein; loc=scaffold_13049:join(10268264..10268451,10268511..10269579); ID=FBpp0227762; name=Dvir\GJ13345-PA; parent=FBgn0200570,FBtr0229270; dbxref=FlyBase:FBpp0227762,FlyBase_Annotation_IDs:GJ13345-PA,GB_protein:EDW69605,REFSEQ:XP_002047263,FlyMine:FBpp0227762; MD5=f1c2af0f9920b865348f355fc9f73ab8; length=418; release=r1.2; species=Dvir;
Sequence
MPRNGGDAGNGGTGASATSDGCIYPDDVILEKGVTFNVRYTGCVEVKTSMKSLDFETRTL
LARECINRVCEAAGLKSASKRRLDKKLHNFISDRPSMQHAGTNIIINVSSRALTLSNVET
GEVIANHNMPRISFASGGDNDTLDFLAYIAKREGDEWRACYVLECAGGQSEDLIVTIGKA
FVLRFNALSRQNEHAASAAADNLNQSCKENVKEYYNDLPNKLPPDLPCEEQPQPLAQLPF
NPHAPRVAQLNLKKPRDRLSSNLIDLNSPPPDQTTNKLALGNFDPLQAASVAGPAPSSIR
DVFDGPQCPLTAEIWFHAAISRPIAERLLQQDGDFLVRESQGKRGQYVLTGLEGKTPKHL
LLIDPEGVVRTKDRIFDSISHLINYHWVHALPIISEDSELVLRNPVRRPNLDQAADSA
Download sequence
Identical sequences B4LHQ2
XP_002047263.1.90633 7244.FBpp0227762 FBpp0227762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]