SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227775 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227775
Domain Number 1 Region: 79-136
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000017
Family Tachycitin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227775   Gene: FBgn0200583   Transcript: FBtr0229283
Sequence length 177
Comment type=protein; loc=scaffold_13049:join(10471296..10471382,10471775..10472112,10472173..10472281); ID=FBpp0227775; name=Dvir\GJ13358-PA; parent=FBgn0200583,FBtr0229283; dbxref=FlyBase:FBpp0227775,FlyBase_Annotation_IDs:GJ13358-PA,GB_protein:EDW69635,REFSEQ:XP_002047293,FlyMine:FBpp0227775; MD5=47ebb91d8efc13b8cffc409f918267f2; length=177; release=r1.2; species=Dvir;
Sequence
MLKLNSKAQLTRLATLLLVVGPALAVEVQKFGYLFNPPQPEHHERREDKQDLNKIPGVAG
VDYPIYHEVPHTQFSCHNVPAVPGMYANVETGCQAYHVCHDGREGHQGASFLCTNGTIFN
QKEFACDWWYNVKCEEAISLYHLNADPEHNPYVPKKKPELEHEAHAPHGGAGFLIHA
Download sequence
Identical sequences B4LI68
7244.FBpp0227775 XP_002047293.1.90633 FBpp0227775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]