SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227821 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227821
Domain Number 1 Region: 831-901
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000157
Family Tachycitin 0.035
Further Details:      
 
Domain Number 2 Region: 144-209
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000968
Family Tachycitin 0.015
Further Details:      
 
Domain Number 3 Region: 348-413
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000235
Family Tachycitin 0.028
Further Details:      
 
Domain Number 4 Region: 540-605
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000034
Family Tachycitin 0.06
Further Details:      
 
Domain Number 5 Region: 696-763
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000262
Family Tachycitin 0.015
Further Details:      
 
Domain Number 6 Region: 236-302
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000199
Family Tachycitin 0.015
Further Details:      
 
Domain Number 7 Region: 1013-1071
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000167
Family Tachycitin 0.096
Further Details:      
 
Domain Number 8 Region: 42-104
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000209
Family Tachycitin 0.024
Further Details:      
 
Domain Number 9 Region: 435-507
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000123
Family Tachycitin 0.064
Further Details:      
 
Domain Number 10 Region: 610-679
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000157
Family Tachycitin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227821   Gene: FBgn0200629   Transcript: FBtr0229329
Sequence length 1072
Comment type=protein; loc=scaffold_13049:join(11400287..11400293,11400389..11403600); ID=FBpp0227821; name=Dvir\GJ13404-PA; parent=FBgn0200629,FBtr0229329; dbxref=FlyBase:FBpp0227821,FlyBase_Annotation_IDs:GJ13404-PA,GB_protein:EDW69719,REFSEQ:XP_002047377,FlyMine:FBpp0227821; MD5=f72f6353abfade7370b7a4ddfef7b921; length=1072; release=r1.2; species=Dvir;
Sequence
MKAHAWDWLPVLFVLVAACLALRGEPRHETCNNEKRYENQVMCAGVQFGYRAPYPDNCSL
YLVCDCEYPTVLPCPGQLWWNNDTQNCDWPQNTKCIYYNIDTTPKTTKATTAATPPSTTP
MTSTTDQNWPTSSYDPPPPPPGIPFTFCRNLPDGSVHRYPYDCNAYINCTHGYPVLNYCE
PDKVFNQVLLICDTPETADCEPLPLPPITTEHPTETTTAEPTTATEDVECGAPPFGIEED
YCVPLGNGFYEYPYDCSAYISCRQGCTYKDFCIPDKLFNPILHICDTPNSVHCNPKPYPT
TTIATTPGSTEDPSTSTNGGESVTPDSSTTTTTVATTTTPALPADVDPDLCVGLPDYTRF
PYAADCSQFLQCSNNQVIVGQCAEPLLFNPDFLICDSADDVICYGDRTTTTSTTSTTEAP
TTTTSSTTVTTTPTTTPGPDKLCANEPFYTTFPYVQDCTSYILCLGDGEYYIAKCISNTY
YDPKTGDCGANVLPTACREQDTTTTRTTEATTEKTTTEVVTSISTPTTSVATTTSPTPGQ
PGGICGSRDEGELIAYPNDCSKYIVCVTPIPVAFYCRPGSYFSAKQQQCVSWEDSDCDKD
TATTPGYTGPPLEPTMCTNSSRDTFPYPENCQWFIRCVNDYIYMMDVCNCGEYYDPINGK
CGADVPSDACRWDYTSTTTEATPTPTTTEPTPVTRPPPQEGPCDDAADGELVPYPDDCSK
YIKCDRPIAAAYDCADGDEFSPVLRECMEASLANCTVGTTPGHTESTTGPTTPSWPGSTT
GSDTTTDSTSNPASTTTPEISTTSETSTTPETSEPSSSTTPETTTTQRTTTPAPSGGICS
GKPNGTLVPYPNNCGKYIVCQEPIPIGYDCPENLEFSPTELECMDPELANCEPRPTTATT
TAPTTTEWTTTPSCDTSPNTTPTTPTTTTTPDTTGSTTPETSETDSTSTTPEASTITTFT
TEWTTTPPCDTSPNTTPTTPTTTTTPDTTASTTPETSETDSTSTTPATTTIHPDTPNICC
GHPLGTILPYPNDCNRYVVCDYPIPYAVVCEEGTVFDVEYLQCTTNGKGSCI
Download sequence
Identical sequences B4LBD1
FBpp0227821 7244.FBpp0227821 XP_002047377.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]