SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227838 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227838
Domain Number 1 Region: 246-292
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000575
Family Tachycitin 0.042
Further Details:      
 
Domain Number 2 Region: 103-166
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000034
Family Tachycitin 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227838   Gene: FBgn0200646   Transcript: FBtr0229346
Sequence length 295
Comment type=protein; loc=scaffold_13049:join(11724951..11724980,11725054..11725911); ID=FBpp0227838; name=Dvir\GJ13421-PA; parent=FBgn0200646,FBtr0229346; dbxref=FlyBase:FBpp0227838,FlyBase_Annotation_IDs:GJ13421-PA,GB_protein:EDW69750,REFSEQ:XP_002047408,FlyMine:FBpp0227838; MD5=dd3c8d79aa09153253c2909522f646c3; length=295; release=r1.2; species=Dvir;
Sequence
MSFRQLHFSLLLLNVINLLTAATVTTRIIQPRETSNCEGRQTPGPICESCELLATCVQHS
NGWVNIPVESCDVANGYFCNMRLGTCSNATGPCHPFGIVGNFQCTSQGIFPDPYDCQKYH
MCYFVGATLVAAAVDCGNDKAFDARTGQCSMTLQSSVCTQPQYHCPKVGYVAAWPSNPNI
FYVCKSTVNQNLNDTVVIYPSLHRCNDGEIFADFVCRPGNNLPVVPTTQPDVVDPNDDGF
TVLPIACEHVGLIADMNDCHKYYYCSAVNGEMRHLECPSGTFYRPEQAACVLGTC
Download sequence
Identical sequences B4LBG2
7244.FBpp0227838 FBpp0227838 XP_002047408.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]