SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227839 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227839
Domain Number 1 Region: 104-164
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000209
Family Tachycitin 0.013
Further Details:      
 
Domain Number 2 Region: 226-277
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000366
Family Tachycitin 0.036
Further Details:      
 
Domain Number 3 Region: 238-364
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000204
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0227839
Domain Number - Region: 163-208
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0418
Family Antifungal peptide scarabaecin 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227839   Gene: FBgn0200647   Transcript: FBtr0229347
Sequence length 370
Comment type=protein; loc=scaffold_13049:11726076..11727188; ID=FBpp0227839; name=Dvir\GJ13422-PA; parent=FBgn0200647,FBtr0229347; dbxref=FlyBase:FBpp0227839,FlyBase_Annotation_IDs:GJ13422-PA,GB_protein:EDW69751,REFSEQ:XP_002047409,FlyMine:FBpp0227839; MD5=ac9cb08af289f6fe99d9e2b38627c880; length=370; release=r1.2; species=Dvir;
Sequence
MSFPKLLPLLLVGCLVRCQAGIVNSSLGIDSAELVTNPCQEVRLAGFVCVDCSTLGFCSH
VDGQWQTISMTECQTERGFFCSDEGTIGCTWQPKCQVPVRGKFYCQLPGIFPDPYDCRSY
HDCNEQNVDTPRQCTNGAAYSLLTHSCSMPRDSEQCTEKQYSCSYVGQTGAWAANSSYYY
VCQKDKQGGQDIFYPLMMKCSDGYTFNGHSCIRPISSKRIAPAQVLSVCQEGLLYPANTV
NGYFSCINGDLSYESCPVGYKFDATARTCLKESDICQEGMSYPAETKYGFNFCFDGTLIY
QKCPVGYYFDLSDGQCIKEEETCENFQLYAADTEHGYLLCLNGELSYYTCPEGTSFDGTG
AVCMPKRAED
Download sequence
Identical sequences B4LBG3
XP_002047409.1.90633 7244.FBpp0227839 FBpp0227839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]