SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0227840 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0227840
Domain Number 1 Region: 86-132
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000314
Family Tachycitin 0.036
Further Details:      
 
Domain Number 2 Region: 28-70
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000863
Family Tachycitin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0227840   Gene: FBgn0200648   Transcript: FBtr0229348
Sequence length 135
Comment type=protein; loc=scaffold_13049:11727458..11727865; ID=FBpp0227840; name=Dvir\GJ13423-PA; parent=FBgn0200648,FBtr0229348; dbxref=FlyBase:FBpp0227840,FlyBase_Annotation_IDs:GJ13423-PA,GB_protein:EDW69752,REFSEQ:XP_002047410,FlyMine:FBpp0227840; MD5=183addffd0b5dfb557cf058df115e3e2; length=135; release=r1.2; species=Dvir;
Sequence
MNSRNLLLLLLVSLATLQVILAVDSPACRNGMLYPGESIYTYYYCVNGALKDGKCPEGSY
FDANFLMCRHGAPPVGSDDAEITNGECQRWGLVADLTDCNRFYHCQNKGATMERLSCDQG
LIFDESKFTCVVGQC
Download sequence
Identical sequences B4LBG4
7244.FBpp0227840 XP_002047410.1.90633 FBpp0227840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]