SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228003 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228003
Domain Number 1 Region: 37-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000017
Family Tachycitin 0.017
Further Details:      
 
Domain Number 2 Region: 162-211
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000288
Family Tachycitin 0.01
Further Details:      
 
Domain Number 3 Region: 227-278
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000149
Family Tachycitin 0.025
Further Details:      
 
Domain Number 4 Region: 97-154
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000246
Family Tachycitin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228003   Gene: FBgn0200808   Transcript: FBtr0229511
Sequence length 283
Comment type=protein; loc=scaffold_13049:join(14843998..14844013,14844415..14844588,14844642..14845078,14845137..14845361); ID=FBpp0228003; name=Dvir\GJ13586-PA; parent=FBgn0200808,FBtr0229511; dbxref=FlyBase:FBpp0228003,FlyBase_Annotation_IDs:GJ13586-PA,GB_protein:EDW70058,REFSEQ:XP_002047716,FlyMine:FBpp0228003; MD5=cafb371f25ef28ec6fdc4112ef18e708; length=283; release=r1.2; species=Dvir;
Sequence
MQKLRLAESNSTEIDLIEAPGPEEIILDGSSLYNVDNISLCKDVANRVFLPYVGDCRKYY
LCWDGEAVEKQCNKDYEFNARNQSCGYPNSSTCMPKCEAYNLTTFCYDRTCTRYVLCYFG
IPVLRECHDGLQYNAETDRCDFPQYVDCVDNECMRLSETTELLYLPSKASCSKYFLCAKG
VPINYNCAEGLYFNTRCNCCDYPENSDCQIPALKRNIQPYARVPLRTADVICPDHGVHFY
AHKSRRDAYYYCIEGHGVTLDCTPGLWYDAVVKECREPKYIGH
Download sequence
Identical sequences FBpp0228003 7244.FBpp0228003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]