SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228004 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228004
Domain Number 1 Region: 128-185
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000107
Family Tachycitin 0.016
Further Details:      
 
Domain Number 2 Region: 200-252
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000209
Family Tachycitin 0.051
Further Details:      
 
Domain Number 3 Region: 71-129
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000288
Family Tachycitin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228004   Gene: FBgn0200809   Transcript: FBtr0229512
Sequence length 257
Comment type=protein; loc=scaffold_13049:join(14848176..14848233,14848301..14848791,14848852..14849076); ID=FBpp0228004; name=Dvir\GJ13587-PA; parent=FBgn0200809,FBtr0229512; dbxref=FlyBase:FBpp0228004,FlyBase_Annotation_IDs:GJ13587-PA,GB_protein:EDW70060,REFSEQ:XP_002047718,FlyMine:FBpp0228004; MD5=29f21bf65ffd090c9328362e953fd8df; length=257; release=r1.2; species=Dvir;
Sequence
MADSLLPYVGNCSKYVICEGGNLTSYGSCYEEEPVKQLCDGNITDCEILFDYKFQSCVSA
RDSDVKCLPECEAYNLTSFCYDRTCTKYVLCYYGIPVLRECYDGLQYNAETDRCDFPEYV
DCVENDCPQYMSISNIRYVASKAQCSKYFICSDGMPWPQECASGLFFNPKCNCCDYASNV
ECKETPQQRNIQPYSRSPPRRADIVCPSQGIHFYAHKSRRDAYYYCVEGHGVTLDCTPGL
LYDSKKYECRQPKYIGI
Download sequence
Identical sequences 7244.FBpp0228004 FBpp0228004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]