SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228008 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228008
Domain Number 1 Region: 123-178
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000759
Family Tachycitin 0.044
Further Details:      
 
Domain Number 2 Region: 25-87
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000034
Family Tachycitin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228008   Gene: FBgn0200813   Transcript: FBtr0229516
Sequence length 180
Comment type=protein; loc=scaffold_13049:14858721..14859263; ID=FBpp0228008; name=Dvir\GJ13591-PA; parent=FBgn0200813,FBtr0229516; dbxref=FlyBase:FBpp0228008,FlyBase_Annotation_IDs:GJ13591-PA,GB_protein:EDW70063,REFSEQ:XP_002047721,FlyMine:FBpp0228008; MD5=6a4e59b6b0ae23c6c9979a91f5608c14; length=180; release=r1.2; species=Dvir;
Sequence
MCQLKELIKPICLVLLAVGLPSSQADVFPQCANVDVDTFVMAIDDCASYIYCNGENSFRD
SCPNQTYFDAKAQECAFDDAGVCLEASGTTTAAALPSENNDELQAASTAPAAPEDTPAPA
GSRPHCDASGDGYHPHPERCEYYYSCIGGYLTIVRCPYTYGWDYAQQQCKPLSEAQCFSL
Download sequence
Identical sequences B4LE20
FBpp0228008 XP_002047721.1.90633 7244.FBpp0228008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]