SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228146 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228146
Domain Number 1 Region: 140-191
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000135
Family SAM (sterile alpha motif) domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228146   Gene: FBgn0200950   Transcript: FBtr0229654
Sequence length 202
Comment type=protein; loc=scaffold_13049:join(17882521..17882548,17882611..17883191); ID=FBpp0228146; name=Dvir\GJ13729-PA; parent=FBgn0200950,FBtr0229654; dbxref=FlyBase:FBpp0228146,FlyBase_Annotation_IDs:GJ13729-PA,GB_protein:EDW70343,REFSEQ:XP_002048001,FlyMine:FBpp0228146; MD5=356984727196e635d35d8ba608537f6e; length=202; release=r1.2; species=Dvir;
Sequence
MDRYNRAWRDPRSPLTPLTPLTTRVFNFDVTPSPPRPNLRRPKTEMKFRRPKLSHLTVPH
QTAETRRGSTGDWGPRHFSQDFMRIRSVFSPTAQSTASQTVTTTPKPHAQSTQQTGGTAA
VTHSKRQFKCSSPVDQPTLSPRVSSLLSRTGNEHLTELFTRQEIDLQVLIQMTLEDLESL
GVRGVKELKLAIDVIKFAKKFF
Download sequence
Identical sequences B4LFM5
7244.FBpp0228146 XP_002048001.1.90633 FBpp0228146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]