SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228173 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228173
Domain Number 1 Region: 283-347
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000602
Family Tachycitin 0.029
Further Details:      
 
Domain Number 2 Region: 218-281
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000602
Family Tachycitin 0.051
Further Details:      
 
Domain Number 3 Region: 359-424
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000105
Family Tachycitin 0.056
Further Details:      
 
Domain Number 4 Region: 148-208
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000942
Family Tachycitin 0.029
Further Details:      
 
Domain Number 5 Region: 27-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000183
Family Tachycitin 0.049
Further Details:      
 
Domain Number 6 Region: 425-475
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000162
Family Tachycitin 0.057
Further Details:      
 
Weak hits

Sequence:  FBpp0228173
Domain Number - Region: 86-119
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00118
Family Tachycitin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228173   Gene: FBgn0200977   Transcript: FBtr0229681
Sequence length 477
Comment type=protein; loc=scaffold_13049:join(18489533..18489539,18489622..18489966,18491582..18492663); ID=FBpp0228173; name=Dvir\GJ13756-PA; parent=FBgn0200977,FBtr0229681; dbxref=FlyBase:FBpp0228173,FlyBase_Annotation_IDs:GJ13756-PA,GB_protein:EDW70408,REFSEQ:XP_002048066,FlyMine:FBpp0228173; MD5=c947f54521082e14b9fcc76513587da5; length=477; release=r1.2; species=Dvir;
Sequence
MTAFHLKAFAAFAVACLLLATQAEAYTMDNMCAQWSGTGYIGNPTDCTSWGYCKNQELVA
TGSCTKGEVYEPQSQSCQYASTTPCTTSAKETCAALKTAGFVAEPSDCTKYTYCFGDARV
VLPLLALTLVGVASAVSKLDDFDHLTTVEMCELLPSDTSFLRPNTCNNWVTCPINGTTIE
EGTCAAGLHYNKDQGRCTMASNVVCPYANTADSGTNALVNACANETDGTFLADPSSYNCH
GYLLCKGRREFKADCPNELVFNPRSRSCVYSTQYSCPTSSTKTTSPVCRALPNNTRLANE
EHCHKYYVCLNEVLHERECAAQMAYDVSLGRCVAAANATCYATAALPPPENTFCMVNGTT
ARQGYFADDESCSHYYICKAPANGKHDTNPQHLQCPLGSYFDVEKLSCRDRVNVRCTLDR
CADFALTYVNVLGDCQAYARCSNGVRVSIGHCPTDYYFDERSQGCTPTNHNYVACSA
Download sequence
Identical sequences 7244.FBpp0228173 FBpp0228173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]