SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228174 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228174
Domain Number 1 Region: 263-323
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 6.28e-17
Family Tachycitin 0.028
Further Details:      
 
Domain Number 2 Region: 31-90
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000942
Family Tachycitin 0.0042
Further Details:      
 
Domain Number 3 Region: 147-206
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000706
Family Antifungal peptide scarabaecin 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228174   Gene: FBgn0200978   Transcript: FBtr0229682
Sequence length 324
Comment type=protein; loc=scaffold_13049:join(18496392..18496493,18496549..18497421); ID=FBpp0228174; name=Dvir\GJ13757-PA; parent=FBgn0200978,FBtr0229682; dbxref=FlyBase:FBpp0228174,FlyBase_Annotation_IDs:GJ13757-PA,GB_protein:EDW70410,REFSEQ:XP_002048068,FlyMine:FBpp0228174; MD5=374578e09513d398fba63f08a3f0828d; length=324; release=r1.2; species=Dvir;
Sequence
MEIRMHFALLVGVCFGVAQAAEQPIHIEIADLSHICEGLTDGHLVPHPLDCNAYFACGSL
ATLQYCEEGLHFDAAELVCDVPEKAKCTAMEGIYAVTTTAPGGNLDPAIGAKPYVDYNWW
MGKPQPVFVAVDVETGQAVNPMEKYDPEHVECRHFGAYFLPHPSNCQLYFICAYGHLHRH
QCGRGTLWNYRSSECQLRTNAECYNYSQEPLVDEPKEPSTTSGQVTICYIVNTSSALPSL
SSDRESTTSASAPTPPSAPPSAPHSALKCPSERQSYLPHPDDCGKYYICIAGMPVLTTCP
KGLYWDQKAGYCDQAKNVKCFQNQ
Download sequence
Identical sequences 7244.FBpp0228174 FBpp0228174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]