SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228178 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228178
Domain Number 1 Region: 221-274
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000141
Family Tachycitin 0.051
Further Details:      
 
Domain Number 2 Region: 148-208
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000549
Family Tachycitin 0.011
Further Details:      
 
Domain Number 3 Region: 32-85
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000123
Family Tachycitin 0.031
Further Details:      
 
Domain Number 4 Region: 92-144
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000118
Family Tachycitin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228178   Gene: FBgn0200982   Transcript: FBtr0229686
Sequence length 324
Comment type=protein; loc=scaffold_13049:join(18541184..18541193,18541281..18542245); ID=FBpp0228178; name=Dvir\GJ13761-PA; parent=FBgn0200982,FBtr0229686; dbxref=FlyBase:FBpp0228178,FlyBase_Annotation_IDs:GJ13761-PA,GB_protein:EDW70418,REFSEQ:XP_002048076,FlyMine:FBpp0228178; MD5=1539200186cce2355881920a9c5293a8; length=324; release=r1.2; species=Dvir;
Sequence
MKSKLQQLIIVLLLHLVAIKATSRSDHLAIERQCRNALVWTLLPDEQHCDRFYVCTGRKE
HNRNYQELRCAAGYHFSSYEQRCIRGACSQPVSRTCNATDVNNVQRLLGDCTRFERCSSR
GELALVKCSYGHYFDAERHACLPVAITPSHQCSCILPEHSTLANLEDCRSYYRCTEGQAV
LQQCPQDYYYELRVNSCLLDTRGVCKPGEPAPLLGEMLQECDREGSRLVPHTQDCSRYFV
CIGSRAIELSCPKGQYFDVLSRYCTIDENFQCLKQSTGSTQPMTTASPATTKEVNSSKQA
QKLNGNKPAFDVIGNKLSSKFLLV
Download sequence
Identical sequences FBpp0228178 7244.FBpp0228178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]