SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0228256 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0228256
Domain Number 1 Region: 2248-2400
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.17e-34
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00078
Further Details:      
 
Domain Number 2 Region: 2079-2224
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.79e-30
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0008
Further Details:      
 
Domain Number 3 Region: 1127-1187
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000474
Family ATI-like 0.029
Further Details:      
 
Domain Number 4 Region: 2967-3027
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000818
Family ATI-like 0.04
Further Details:      
 
Domain Number 5 Region: 752-813
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000948
Family ATI-like 0.024
Further Details:      
 
Domain Number 6 Region: 1856-1914
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000314
Family Tachycitin 0.054
Further Details:      
 
Domain Number 7 Region: 3637-3707
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000701
Family VWC domain 0.032
Further Details:      
 
Domain Number 8 Region: 1247-1298
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000785
Family BSTI 0.059
Further Details:      
 
Domain Number 9 Region: 194-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0228256
Domain Number - Region: 791-852
Classification Level Classification E-value
Superfamily FnI-like domain 0.000502
Family VWC domain 0.065
Further Details:      
 
Domain Number - Region: 1933-2005
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000834
Family ATI-like 0.039
Further Details:      
 
Domain Number - Region: 3311-3389
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00129
Family ATI-like 0.071
Further Details:      
 
Domain Number - Region: 2516-2549
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00157
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number - Region: 1298-1338
Classification Level Classification E-value
Superfamily FnI-like domain 0.0022
Family VWC domain 0.056
Further Details:      
 
Domain Number - Region: 1672-1726
Classification Level Classification E-value
Superfamily FnI-like domain 0.0101
Family VWC domain 0.021
Further Details:      
 
Domain Number - Region: 290-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0262
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0228256   Gene: FBgn0201058   Transcript: FBtr0229764
Sequence length 3842
Comment type=protein; loc=scaffold_13049:join(19495365..19495471,19495735..19495824,19495883..19495996,19496064..19496111,19496169..19496564,19496631..19496758,19496829..19496924,19496995..19497192,19497254..19497420,19497478..19497635,19497753..19497907,19497973..19498575,19499282..19500403,19500463..19501356,19501513..19502061,19502116..19503435,19503494..19503563,19503626..19503881,19503991..19504729,19504797..19505288,19505344..19505850,19505912..19506395,19506459..19508242,19508313..19508528,19508591..19509046,19509103..19509359,19509422..19509544); ID=FBpp0228256; name=Dvir\GJ13839-PA; parent=FBgn0201058,FBtr0229764; dbxref=FlyBase:FBpp0228256,FlyBase_Annotation_IDs:GJ13839-PA,GB_protein:EDW70551,REFSEQ:XP_002048209,FlyMine:FBpp0228256; MD5=591d62efa28bed71e753098df399e322; length=3842; release=r1.2; species=Dvir;
Sequence
MANKYIYFLAWLLIFSQVCAEEGDIVMSDDDDQSIDPLARAVPEADNQERDERHLNFKIH
RAPAVSARYSYAYNDGVGQGGAGGGGGGYGAQHGAFMGGIKTSGSHLMNNALGLLGIGKG
VKSNFYGNAAQQLRAYGKCAAITLPQNVQSQCDGNGRCQVYCPDGYTFAPDTKQLELFCS
NDGWIIRNTEFSRVPPCQATCMPPCQNNGICLAAGVCQCPENYSGPLCQHKKSVCAAKPP
VPKNSKVSCKNNLCHAECMRGFQFPDGSGITNIECRNGQWLHTKTGLAKMPDCGPTCSPA
CQNGGQCISFNICQCSKMHRGAFCQYSISSCNVTNTHFNGNYKCAYDTEEARCTFSCPEV
RGLKVQGRLDIEYKCKYQQGVYLPAPLPKCVFPPGYTIKSGSVQVTHMQQAGRSYHGAFS
GEITSELRSQREILLALLAKYKDLERRSEWWSSEETVTTLGSYSLYMSSEVDVVVDKSPR
PALCTTWGGINIKTFDGLVFKAPLSCSHTLTTDKVSGTFDVTLKACPYGSGYGCAHTLKI
QWQSVLYTLENLNGTMRLSTPTKQLPIPVQVMGMKVMPVAQHVQIDLESIGLKLDWDHQQ
YVAVHAGPAMWGKVGGLCGSLDGDYSNDLMSRTGKKLETVKAFADAWRVDDSSEMCRVEN
SAEMEFGIESCEQSKLQKAVSTCERLLANEKLSDCIKPFNYDALIRTCMADYCNCPNREK
PESCNCDAIAMLAKECMFKGIQLQHGWRNLEVCPISCGFGRVYRACGPDVEPTCESDLTS
SSPTKGKCNEGCFCPEGTVQYKDACITRELCPCTLRGREFKPEATIKKNCNTCTCKNGQW
KCTDDKCGARCGAIGDPHYHTFDGKRYDFMGKCSYYLLKTPNMSVEAENVACSGAVSEAL
SYAAPDDPSCTKSVTIRFLLRDGTPATIKLDQGLTTVINDKPIAKLPKMMGLGEVLIRRA
SSTFLTVEFAGGIRIWWDGVSRVYVDAPASWRGQTQGLCGTFNSNTQDDFLTPEGDVETA
IEAFADKWRTKDTCQFQAETHQGPHPCTLSPEKKALAEKHCDWILQDIFQECHFMVEPEQ
YYEDCLYDTCACKDDPEKCFCPILSAYGTECMRQGIKTGWRMTVKECAVKCPMGQVFDEC
GDGCALTCDDLPGKNSCTRECVEGCRCPHGEYINDQGVCVPKHKCHCSFDGMIFRPGYKE
VRPGGKFLDLCTCADGVWDCQDADPGDDVKYPPSSELRSKCAKQPYAEFTKCAPKEPKTC
KNMDKYVAESADCLPGCVCMEGYVYDTSRLACVLPTNCSCHHAGKSYDDGEKIKEDCNSC
VCQAGNWKCSENGCESTCSVWGDSHFTTYDGHDFDFQGACDYVLSKGVFDNGDGFTITIQ
NVLCGTMGVTCSKSLEIALTGRVQESLLLSADATYSVDPNKSAIKKLRDSVNSKGHNTFH
IYKSGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRNKVSGLCGNYNGNSRDDMQTPSLG
LETSAMLFGHAWKLQPHCAAPVAPIDACRQHPERETWAQLKCGALKSELFEPCHAEVPLE
RYLKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSEYK
SCTPACAVETCDNFLDQGIAERMCNRENCIEGCHIKPCQDGFIYLNDTYRECVPKAECKP
VCMVKDGKTYYEGDITFQDACATCRCSKRKEICSGVKCDAPAAAPTPAPLVQGTTEKPLA
TQNQTKCVRGWTRWFDNDADATEKTVRLNDEEKLPRYDRLENIYGTCLKQYMTKVECRVK
NTHEPPEQMDENVACSLAVGLRCIGKCHDYELRVFCQCDAEPEPTTSKPIEKPQIGGSCD
VGVVEYKEYPGDCHKFLHCQPKGVDGGWVYVEKTCGESMMFNPTMFNCDHIAIVQELIPS
CGKRKPDPEPEHIMQCDEGKVWSECANQCENTCHFYGSILRKRGLCQRGEHCKPGCVDKL
RPDCPKLGKYWRDENTCVHADECPCMDKAEQYVQPHKPVVGELEICQCIDNAFTCVPNKP
EPTPEPTQRPFEPIVPILPVTLTPPLHCAPERLIPMIENGPHSLPDSIFNASSKLAPDHA
PHKARLTKNPKTGSGSWSPQINDQMQYLEVNFGHAEPIYGVIMAGSPEFNNYVTLFKILH
SHDGIAYNYLVDETDKPQMFNGPLDSREPVRTFFKIPIEASSLRIYPIKWHGSIAMRVEL
LICGELPTVTPSPTLPTSTEHPTLSLELECVDELGVDKGEMHERQLQASSLWQLHQSARK
PRLLDLLKLSNAQAWRPLANTPNEFIEFDFLEPRNVSGFITKGGPDGWVTGYKVMFSKKK
PTWNTVLAPNGQPRIFEANVDEHTPRTHHFKNPILTQYLKIVPAKWERNINMRIEPLGCF
KPYPVLKEELIEATHEPTKCNVCDGIASSSPSSDSKCQCSDQLYWDGNKCVQRNLCPCVE
NYVSYPIGSKFENAACEECVCVLGGRNNCKPKKCPPCEERHLRRVITSDCFCKCEPCPKQ
QRLCPSSGDCIPEILWCNGVQDCADDEDASCRDSFTVEPDIKREKNETTVITCPAPVCPP
QMKIKIIEKKARKMSKIFSFHKQVSIVDDGVSITKTKFVSSNEQVLAMPNNELNYQEEEE
CSEFTCVPIPTKEVNKNETITCVEPKCPEKYDVELDMSTAKAGDCLKYTCVLRPNKDDVC
EISGKSFTTFDGTLFKYSPCSHILARDINNGSWTISVHQQCSDETRKVCHKVVTIQDLQA
GNELVLLPHLKIKFNGFEFTVEQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIG
ILKVGISSKFLRTVDGLCGYYNGNPRDDKRTPDGQVLANTEKFGNSWYDKRVPLDQCGDQ
KCTRQLQAKALQLCNIINHPTFAKCHKAVNYKQFSNNYCLEAACDCLQANNGDATACKCN
ILESFVKKCLSVNPLAQLTTWRAVHQCEISCPAPLVHTDCYKRRCEPSCDNLHGDDCPVL
PDVCFPGCYCPEGTVRKGPKCVPIADCKDCVCKALGSSNYMTYDRKSFSFNGNCTYLLSR
DVVLPGVHTFQVYVSMDDCKKLGQVSAINGTSCAKSLHVLNGDHVIHVQRVPQQPKALQV
LVDGFEVKKMPYKDSWITLRQVVGKELVLNLPESHVELTASFEDLIFTLGVPSIKYGSKM
EGLCGDCNEDASNDLQPNPAKKKPGIDVIQSWQADEPKLGLTDAQECLSEDVPKENCLPL
PPEKDPCLQFYNEELFGKCPLVVDPIAYVSACQQDICKPGNTQQGVCVSLAAYAKECNKQ
GICTNWRRPQLCPYDCPSDMVYEPCGCAKNCDTVKAMSEYDAVNVKTQTVFHTVNSDDMC
LSSERFEGCFCPAGQVMDGGKCIPEEACTKCDDGVHLPGDKWQPDKCTDCQCDAKGKSSC
VEKKCQVEENICAEGYKPQTIVSAEECCPRYRCVPEPKESQKLCLAPLMPVCGPGQFKKQ
KNDVNGCPQYICECKPKEDCEPLVPPRELLPGEQLVKIDEGCCPTQKIVCKPEQCPPAPV
NCQQRFYEVSTQQAPGACCPTHKCVPPKHLCIVQYEVEESSSFTKQVGDKWPHAKDVCKQ
EQCSYGPNGVAQVISTLEQCVTDCTPGYSYQKLDKTKCCGECVQTSCLFEQKLYEPNAQW
SSPDNCTHYLCLKKDKLLMVSSSNEICPDVSQCAPHLVYVEGCCKRCKLEPQVEDLSTCL
PVSLAESRTKELLKYTKPGHGVCVNAEPIKGFTDCEGACSSGSKYNKHTDMHEKFCTCCS
IKSYQPISVKMVCDDGHTYNQRHEVPSNCGCSPCDEFSEGVIDVRMQGAKQLPMPLLQLL
GH
Download sequence
Identical sequences B4LGT6
FBpp0228256 7244.FBpp0228256 XP_002048209.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]